CDV3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81781

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CDV3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LQSTAKHVESRKDKEMEKSFEVVRHKNRGRDEVSKNQALKLQLDNQYAVLENQKSSHSQYN

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CDV3 Antibody - BSA Free

Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781]

Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781]

Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781] - Staining in human tonsil and pancreas tissues using anti-CDV3 antibody. Corresponding CDV3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781]

Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781]

Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781] - Staining of human cerebral cortex, liver, lymph node and tonsil using Anti-CDV3 antibody NBP1-81781 (A) shows similar protein distribution across tissues to independent antibody NBP1-81779 (B).
Western Blot: CDV3 Antibody [NBP1-81781]

Western Blot: CDV3 Antibody [NBP1-81781]

Western Blot: CDV3 Antibody [NBP1-81781] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-CDV3 antibody. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: CDV3 Antibody [NBP1-81781]

Immunocytochemistry/ Immunofluorescence: CDV3 Antibody [NBP1-81781]

Immunocytochemistry/Immunofluorescence: CDV3 Antibody [NBP1-81781] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781]

Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781]

Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781]

Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781]

Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells.
Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781]

Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781]

Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781]

Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781]

Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781] - Staining of human liver.
Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781]

Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781]

Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81781] - Staining of human lymph node.

Applications for CDV3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDV3

Alternate Names

CDV3 homolog (mouse), H41carnitine deficiency-associated gene expressed in ventricle 3, protein CDV3 homolog

Gene Symbol

CDV3

Additional CDV3 Products

Product Documents for CDV3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CDV3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDV3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CDV3 Antibody - BSA Free and earn rewards!

Have you used CDV3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies