CDX4 Antibody (1E9) - Azide and BSA Free

Novus Biologicals | Catalog # H00001046-M12

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1E9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

CDX4 (NP_005184, 202 a.a. ~ 284 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE*

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Specificity

CDX4 (1E9)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for CDX4 Antibody (1E9) - Azide and BSA Free

Western Blot: CDX4 Antibody (1E9) [H00001046-M12]

Western Blot: CDX4 Antibody (1E9) [H00001046-M12]

Western Blot: CDX4 Antibody (1E9) [H00001046-M12] - Analysis of CDX4 expression in Raw 264.7 (Cat # L024V1).
Immunocytochemistry/ Immunofluorescence: CDX4 Antibody (1E9) [H00001046-M12]

Immunocytochemistry/ Immunofluorescence: CDX4 Antibody (1E9) [H00001046-M12]

Immunocytochemistry/Immunofluorescence: CDX4 Antibody (1E9) [H00001046-M12] - Analysis of monoclonal antibody to CDX4 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: CDX4 Antibody (1E9) [H00001046-M12]

Western Blot: CDX4 Antibody (1E9) [H00001046-M12]

Western Blot: CDX4 Antibody (1E9) [H00001046-M12] - Analysis of CDX4 expression in HeLa (Cat # L013V1).
Western Blot: CDX4 Antibody (1E9) [H00001046-M12]

Western Blot: CDX4 Antibody (1E9) [H00001046-M12]

Western Blot: CDX4 Antibody (1E9) [H00001046-M12] - Analysis of CDX4 expression in PC-12 (Cat # L012V1).

Applications for CDX4 Antibody (1E9) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: CDX4

The caudal-type homeobox protein family of transcription factors are involved in early anteroposterior patterning by regulating members of the HOX gene family. CDX proteins contain a caudal-like activation domain and a DNA-binding homeodomain. CDX2 promotes intestinal patterning and development, while CDX4 regulates hematopoiesis and proliferation and differentiation of epithelial lining in the gut. Caudal homologs are associated with various diseases including cancers of the gut epithelium.

Long Name

Caudal-type Homeobox Transcription Factor 4

Alternate Names

caudal type homeo box transcription factor 4, caudal type homeobox 4, caudal type homeobox transcription factor 4, Caudal-type homeobox protein 4, homeobox protein CDX-4

Entrez Gene IDs

1046 (Human)

Gene Symbol

CDX4

OMIM

300025 (Human)

Additional CDX4 Products

Product Documents for CDX4 Antibody (1E9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDX4 Antibody (1E9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDX4 Antibody (1E9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CDX4 Antibody (1E9) - Azide and BSA Free and earn rewards!

Have you used CDX4 Antibody (1E9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies