CEBP gamma Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89742

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CEBP gamma Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CEBP gamma Antibody - BSA Free

Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742]

Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742]

Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742] - Staining in human small intestine and pancreas tissues using anti-CEBPG antibody. Corresponding CEBPG RNA-seq data are presented for the same tissues.
Western Blot: CEBP gamma Antibody [NBP1-89742]

Western Blot: CEBP gamma Antibody [NBP1-89742]

Western Blot: CEBP gamma Antibody [NBP1-89742] - Analysis in control (vector only transfected HEK293T lysate) and CEBPG over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: CEBP gamma Antibody [NBP1-89742]

Immunocytochemistry/ Immunofluorescence: CEBP gamma Antibody [NBP1-89742]

Immunocytochemistry/Immunofluorescence: CEBP gamma Antibody [NBP1-89742] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742]

Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742]

Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742]

Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742]

Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742] - Staining of human small intestine shows high expression.
CEBP gamma Antibody - BSA Free Western Blot: CEBP gamma Antibody - BSA Free [NBP1-89742]

Western Blot: CEBP gamma Antibody - BSA Free [NBP1-89742]

Analysis in control (vector only transfected HEK293T lysate) and CEBPG over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
CEBP gamma Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: CEBP gamma Antibody - BSA Free [NBP1-89742]

Chromatin Immunoprecipitation-exo-Seq: CEBP gamma Antibody - BSA Free [NBP1-89742]

ChIP-Exo-Seq composite graph for Anti-CEBPG (NBP1-89742) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for CEBP gamma Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CEBP gamma

The transcription factor C/EBP alpha (CCAAT-enhancer binding protein) is a heatstable, sequence-specific DNA-binding protein first purified from rat liver nuclei that binds avidly to several different cis-regulatory DNA sequences commonly associated with viral and cellular genes transcribed by RNA polymerase II. C/EBP alpha regulates gene expression in a variety of tissues including liver, adipose, lung and intestine. C/EBP alpha uses a bipartite structural motif to bind DNA. Two protein chains dimerize through a set of amphipathic alpha helices termed the leucine zipper. Highly basic polypeptide regions emerge from the zipper to form a linked set of DNA contact surfaces. C/EBP alpha appears to function exclusively in terminally differentiated, growth-arrested cells. Additional family members include C/EBP beta, C/EBP gamma,C/EBP delta and C/EBP episilon, all of which exhibit similar DNA-binding specificities and affinities to C/EBP alpha. Furthermore, C/EBP beta and C/EBP delta readily form heterodimers both with each other as well as with C/EBP alpha.

Alternate Names

c/EBP gamma, CCAAT/enhancer binding protein (C/EBP), gamma, CCAAT/enhancer-binding protein gamma, GPE1BP, IG/EBP-1

Gene Symbol

CEBPG

Additional CEBP gamma Products

Product Documents for CEBP gamma Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CEBP gamma Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CEBP gamma Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CEBP gamma Antibody - BSA Free and earn rewards!

Have you used CEBP gamma Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies