cGAS Antibody
Novus Biologicals | Catalog # NBP3-16666
Scientific images may be resized, cropped, or adjusted for brightness or contrast for presentation purposes. These updates are limited to presentation and do not affect the underlying scientific interpretation of the data. Where available, additional source data may be provided upon request.
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Rat
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 350-522 of human cGAS (NP_612450.2). KQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIEYERNNEFPVFDEF
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for cGAS Antibody
Western Blot: cGAS Antibody - BSA Free [NBP3-16666] -
Western Blot: cGAS Antibody - BSA Free [NBP3-16666] - Western blot analysis of lysates from HeLa cells using cGAS Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
![Immunohistochemistry-Paraffin: cGAS Antibody - BSA Free [NBP3-16666]](https://resources.rndsystems.com/images/products/cGAS-Antibody-Immunohistochemistry-Paraffin-NBP3-16666-img0016.jpg "Immunohistochemistry-Paraffin: cGAS Antibody - BSA Free [NBP3-16666]")
Immunohistochemistry-Paraffin: cGAS Antibody - BSA Free [NBP3-16666]
Immunohistochemistry-Paraffin: cGAS Antibody [NBP3-16666] - Human colon using cGAS Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: cGAS Antibody - BSA Free [NBP3-16666]](https://resources.rndsystems.com/images/products/cGAS-Antibody-Immunohistochemistry-Paraffin-NBP3-16666-img0015.jpg "Immunohistochemistry-Paraffin: cGAS Antibody - BSA Free [NBP3-16666]")
Immunohistochemistry-Paraffin: cGAS Antibody - BSA Free [NBP3-16666]
Immunohistochemistry-Paraffin: cGAS Antibody [NBP3-16666] - Human colon carcinoma using cGAS Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] -
Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] - Immunofluorescence analysis of PC-12 cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] -
Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] - Immunofluorescence analysis of NIH/3T3 cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] -
Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] - Immunofluorescence analysis of U2OS cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Western Blot: cGAS Antibody - BSA Free [NBP3-16666] -
Western Blot: cGAS Antibody - BSA Free [NBP3-16666] - Western blot analysis of lysates from THP-1 cells using cGAS Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
Western Blot: cGAS Antibody - BSA Free [NBP3-16666] -
Western Blot: cGAS Antibody - BSA Free [NBP3-16666] - Western blot analysis of lysates from HT-29 cells using cGAS Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [cGAS] -
Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [cGAS] - Immunofluorescence analysis of NIH/3T3 cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [cGAS] -
Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [cGAS] - Immunofluorescence analysis of U2OS cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Western Blot: cGAS Antibody - BSA Free [NBP3-16666] -
rFGF21 inhibits the activation of cGAS-STING pathway following SAH. (A) GSEA plot showing that the activation of cytosolic dna sensing pathway were activated in the brain from SAH mice, which were then alleviated following rFGF21 treatment. (B) Heatmap showing that differently expressed genes involved in cytosolic DNA sensor pathway. (C-H) Western blot analysis of the effects of rFGF21 treatment on the expression level of cGAS and the phosphorylation level of STING, TBK1, IRF3, and NF-kappa B following SAH operation in mice. (n = 6 per group). Data are presented as means +/- SD. *p < 0.05, **p < 0.01, ***p < 0.001 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38720350), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for cGAS Antibody
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Preservative
0.09% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: cGAS
Alternate Names
C6orf150, c-GAS, cyclic GMP-AMP synthase, h-cGAS, Mab-21 domain containing 1
Gene Symbol
CGAS
Additional cGAS Products
Product Documents for cGAS Antibody
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for cGAS Antibody
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for cGAS Antibody
Powered by Bioz
Customer Reviews for cGAS Antibody
There are currently no reviews for this product. Be the first to review cGAS Antibody and earn rewards!
Have you used cGAS Antibody?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...