cGAS Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-16666

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 350-522 of human cGAS (NP_612450.2). KQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIEYERNNEFPVFDEF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for cGAS Antibody - BSA Free

cGAS Antibody - BSA Free

Western Blot: cGAS Antibody - BSA Free [NBP3-16666] -

Western Blot: cGAS Antibody - BSA Free [NBP3-16666] - Western blot analysis of lysates from HeLa cells using cGAS Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Immunohistochemistry-Paraffin: cGAS Antibody - BSA Free [NBP3-16666]

Immunohistochemistry-Paraffin: cGAS Antibody - BSA Free [NBP3-16666]

Immunohistochemistry-Paraffin: cGAS Antibody [NBP3-16666] - Human colon using cGAS Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: cGAS Antibody - BSA Free [NBP3-16666]

Immunohistochemistry-Paraffin: cGAS Antibody - BSA Free [NBP3-16666]

Immunohistochemistry-Paraffin: cGAS Antibody [NBP3-16666] - Human colon carcinoma using cGAS Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
cGAS Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] -

Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] - Immunofluorescence analysis of PC-12 cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
cGAS Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] -

Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] - Immunofluorescence analysis of NIH/3T3 cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
cGAS Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] -

Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] - Immunofluorescence analysis of U2OS cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
cGAS Antibody - BSA Free

Western Blot: cGAS Antibody - BSA Free [NBP3-16666] -

Western Blot: cGAS Antibody - BSA Free [NBP3-16666] - Western blot analysis of lysates from THP-1 cells using cGAS Rabbit pAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
cGAS Antibody - BSA Free

Western Blot: cGAS Antibody - BSA Free [NBP3-16666] -

Western Blot: cGAS Antibody - BSA Free [NBP3-16666] - Western blot analysis of lysates from HT-29 cells using cGAS Rabbit pAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
cGAS Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [cGAS] -

Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [cGAS] - Immunofluorescence analysis of NIH/3T3 cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
cGAS Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [cGAS] -

Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [cGAS] - Immunofluorescence analysis of U2OS cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
cGAS Antibody - BSA Free

Western Blot: cGAS Antibody - BSA Free [NBP3-16666] -

rFGF21 inhibits the activation of cGAS-STING pathway following SAH. (A) GSEA plot showing that the activation of cytosolic dna sensing pathway were activated in the brain from SAH mice, which were then alleviated following rFGF21 treatment. (B) Heatmap showing that differently expressed genes involved in cytosolic DNA sensor pathway. (C-H) Western blot analysis of the effects of rFGF21 treatment on the expression level of cGAS and the phosphorylation level of STING, TBK1, IRF3, and NF-kappa B following SAH operation in mice. (n = 6 per group). Data are presented as means +/- SD. *p < 0.05, **p < 0.01, ***p < 0.001 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38720350), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for cGAS Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: cGAS

Alternate Names

C6orf150, c-GAS, cyclic GMP-AMP synthase, h-cGAS, Mab-21 domain containing 1

Gene Symbol

CGAS

Additional cGAS Products

Product Documents for cGAS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for cGAS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for cGAS Antibody - BSA Free

Customer Reviews for cGAS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review cGAS Antibody - BSA Free and earn rewards!

Have you used cGAS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...