CHCHD3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83656

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CHCHD3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKRLKQAK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CHCHD3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CHCHD3 Antibody [NBP1-83656]

Immunocytochemistry/ Immunofluorescence: CHCHD3 Antibody [NBP1-83656]

Immunocytochemistry/Immunofluorescence: CHCHD3 Antibody [NBP1-83656] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656]

Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656]

Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656] - Staining of human skeletal muscle shows strong granular cytoplasmic positivity in myocytes.
Western Blot: CHCHD3 Antibody [NBP1-83656]

Western Blot: CHCHD3 Antibody [NBP1-83656]

Western Blot: CHCHD3 Antibody [NBP1-83656] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656]

Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656]

Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656]

Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656]

Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656]

Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656]

Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
CHCHD3 Antibody - BSA Free Western Blot: CHCHD3 Antibody - BSA Free [NBP1-83656]

Western Blot: CHCHD3 Antibody - BSA Free [NBP1-83656]

Analysis in U-87MG ATCC cells) transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CHCHD3 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
CHCHD3 Antibody - BSA Free Western Blot: CHCHD3 Antibody - BSA Free [NBP1-83656]

Western Blot: CHCHD3 Antibody - BSA Free [NBP1-83656]

Analysis in human cell line HEK 293.
CHCHD3 Antibody - BSA Free Western Blot: CHCHD3 Antibody - BSA Free [NBP1-83656]

Western Blot: CHCHD3 Antibody - BSA Free [NBP1-83656]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
CHCHD3 Antibody - BSA Free

Western Blot: CHCHD3 Antibody - BSA Free [NBP1-83656] -

Mitochondrial targeting of mutant renin isoforms. (A) Western blot analysis showing renin expression in the lysates and conditioned media of transiently transfected Calu-6 cells. GAPDH is shown as a loading control. The presence of a non-glycosylated renin isoform (red asterisk) can be seen for all mutants. (B) Cell lysates were deglycosylated with PNGase F. The lower band indicated in panel A with the asterisk is not sensitive to PNGase F treatment, indicating the absence of N-glycans. (C) Immunofluorescence analysis in Calu-6 cells showing merged pictures of renin (red) and TIM44 (marker of mitochondria, green) with nuclei (DAPI, blue). Scale bar: 20 μm. Colocalisation of renin and mitochondria can be assessed by the presence of merged yellow signal. The graph below shows Pearson's correlation coefficient between signals of TIM44 and renin. *P<0.05; **P<0.01; ***P<0.001; ****P<0.0001; two-way ANOVA with Bonferroni post hoc test versus WT. Data are shown as mean+/-s.e.m. (n=3 independent experiments). (D) Protease protection assay performed on isolated mitochondria from HEK293 cells expressing p.L16R or p.W17R mutant isoforms. Western blot experiments showed digestion of renin isoforms by trypsin only when the inner membrane was permeabilised. This result suggests that mutant isoforms are imported within the mitochondrial matrix. Images are representative of three independent experiments. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37283036), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for CHCHD3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 4 using NBP1-83656 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHCHD3

Alternate Names

coiled-coil-helix-coiled-coil-helix domain containing 3, FLJ20420, mitochondrial

Gene Symbol

CHCHD3

Additional CHCHD3 Products

Product Documents for CHCHD3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CHCHD3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CHCHD3 Antibody - BSA Free

Customer Reviews for CHCHD3 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used CHCHD3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Name: Kathleen Emanuel
    Application: Western Blot
    Sample Tested: Protein lysate from mitochondria isolated from SH-SY5Y cells
    Species: Human
    Verified Customer | Posted 06/15/2016
    CHCHD3 Antibody - BSA Free NBP1-83656

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies