Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)

Novus Biologicals | Catalog # NBP3-16518

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9M2G2 expressed in HEK293
View all Clathrin Heavy Chain 1/CHC17 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Clathrin Heavy Chain 1/CHC17 (Q00610). SFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

191 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)

Western Blot: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518]

Western Blot: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518]

Western Blot: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] - Analysis of extracts of various cell lines, using Clathrin Heavy Chain 1/CHC17 Rabbit mAb (NBP3-16518) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunoprecipitation: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518]

Immunoprecipitation: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518]

Immunoprecipitation: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] - Analysis of 300ug extracts of NIH/3T3 cells using 3ug Clathrin Heavy Chain 1/CHC17 antibody (NBP3-16518). Western blot was performed from the immunoprecipitate using Clathrin Heavy Chain 1/CHC17 antibody (NBP3-16518) at a dilition of 1:1000.
Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] -

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] -Human colon carcinoma tissue using Clathrin heavy chain Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] -

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] - Human colon tissue using Clathrin heavy chain Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] -

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] -Human thyroid cancer tissue using Clathrin heavy chain Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)

Immunocytochemistry/ Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [Clathrin Heavy Chain 1/CHC17] -

Immunocytochemistry/ Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [Clathrin Heavy Chain 1/CHC17] - Confocal imaging of HeLa cells using Clathrin Heavy Chain 1/CHC17 Rabbit mAb. The cells were counterstained with alpha-Tubulin Rabbit mAb (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Applications for Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:100 - 1:400

Immunohistochemistry

1:200 - 1:2000

Immunohistochemistry-Paraffin

1:200 - 1:2000

Immunoprecipitation

0.5ug-4ug antibody for 200ug-400ug extracts of whole cells

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Clathrin Heavy Chain 1/CHC17

Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains (192 kDa) and three light chains (LCa or LCb, 25-29 kDa) and self assembles into a polyhedral cytoskeletal element. Self assembly facilitates clathrin's central role in membrane sorting and selective transport within the cell.

Long Name

Clathrin Heavy Chain on Chromosome 17

Alternate Names

CHC17, CLH17, CLTC, CLTCL2

Gene Symbol

CLTC

Additional Clathrin Heavy Chain 1/CHC17 Products

Product Documents for Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)

There are currently no reviews for this product. Be the first to review Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) and earn rewards!

Have you used Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Notch Signaling Pathways Notch Signaling Pathway Thumbnail