Claudin-5 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92846

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 119-218 of human Claudin-5 (NP_001349995.1). LTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Claudin-5 Antibody - Azide and BSA Free

Claudin-5 Antibody - Azide and BSA Free

Western Blot: Claudin-5 Antibody [NBP2-92846] -

Western Blot: Claudin-5 Antibody [NBP2-92846] -analysis of various lysates, using CLDN5 Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: Claudin-5 Antibody - Azide and BSA Free [NBP2-92846]

Immunocytochemistry/ Immunofluorescence: Claudin-5 Antibody - Azide and BSA Free [NBP2-92846]

Immunocytochemistry/Immunofluorescence: Claudin-5 Antibody [NBP2-92846] - Analysis of U2OS cells using Claudin-5 at dilution of 1:100. Blue: DAPI for nuclear staining.
Claudin-5 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Claudin-5 Antibody - Azide and BSA Free [NBP2-92846] -

Immunocytochemistry/ Immunofluorescence: Claudin-5 Antibody - Azide and BSA Free [NBP2-92846] - Immunofluorescence analysis of NIH/3T3 cells using Claudin-5 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Claudin-5 Antibody - Azide and BSA Free

Claudin-5 Antibody - Azide and BSA Free [NBP2-92846] -

Analysis of paraffin-embedded Rat lung tissue using CLDN5 Rabbit pAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Claudin-5 Antibody - Azide and BSA Free

Claudin-5 Antibody - Azide and BSA Free [NBP2-92846] -

Analysis of paraffin-embedded Mouse brain tissue using CLDN5 Rabbit pAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Claudin-5 Antibody - Azide and BSA Free

Claudin-5 Antibody - Azide and BSA Free [NBP2-92846] -

Analysis of paraffin-embedded Rat spleen tissue using CLDN5 Rabbit pAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for Claudin-5 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:1000 - 1:4000

Immunohistochemistry-Paraffin

1:1000 - 1:4000

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Claudin-5

The Claudin superfamily consists of many structurally related proteins in humans. These proteins are important structural and functional components of tight junctions in paracellular transport. Claudins are located in both epithelial and endothelial cells in all tight junction-bearing tissues. Three classes of proteins are known to localize to tight junctions, including the Claudins, Occludin and junction adhesion molecule (JAM). Claudins, which consist of four transmembrane domains and two extracellular loops, make up tight junction strands. Claudin expression is highly restricted to specific regions of different tissues and may have an important role in transcellular transport through tight junctions. Claudin-5 is expressed in the endothelial junctions of the rat liver and in junctions of acinar cells of the pancreas. Human claudin-5 is abundantly expressed in adult lung, heart and skeletal muscle and is deleted in patients with velocardiofacial syndrome, which is characterized by cleft palate, facial dysmorphology and conotruncal heart defects.The human claudin-5 gene maps to chromosome 22q11.21.

Alternate Names

AWAL, BEC1, Claudin5, CLDN5, CPETRL1, TMDVCF, TMVCF1

Gene Symbol

CLDN5

Additional Claudin-5 Products

Product Documents for Claudin-5 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Claudin-5 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Claudin-5 Antibody - Azide and BSA Free

Customer Reviews for Claudin-5 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Claudin-5 Antibody - Azide and BSA Free and earn rewards!

Have you used Claudin-5 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies