CMTM5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47503

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CMTM5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CMTM5 Antibody - BSA Free

Western Blot: CMTM5 Antibody [NBP2-47503]

Western Blot: CMTM5 Antibody [NBP2-47503]

Western Blot: CMTM5 Antibody [NBP2-47503] - Analysis in control (vector only transfected HEK293T lysate) and CMTM5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: CMTM5 Antibody [NBP2-47503]

Immunocytochemistry/ Immunofluorescence: CMTM5 Antibody [NBP2-47503]

Immunocytochemistry/Immunofluorescence: CMTM5 Antibody [NBP2-47503] - Staining of human cell line HEL shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CMTM5 Antibody [NBP2-47503]

Immunohistochemistry-Paraffin: CMTM5 Antibody [NBP2-47503]

Immunohistochemistry-Paraffin: CMTM5 Antibody [NBP2-47503] - Staining in human cerebral cortex and pancreas tissues using anti-CMTM5 antibody. Corresponding CMTM5 RNA-seq data are presented for the same tissues.
Western Blot: CMTM5 Antibody [NBP2-47503]

Western Blot: CMTM5 Antibody [NBP2-47503]

Western Blot: CMTM5 Antibody [NBP2-47503] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line HEL
Immunohistochemistry: CMTM5 Antibody [NBP2-47503]

Immunohistochemistry: CMTM5 Antibody [NBP2-47503]

Immunohistochemistry: CMTM5 Antibody [NBP2-47503] - Staining of human cerebral cortex shows neuropil positivity.
Immunohistochemistry-Paraffin: CMTM5 Antibody [NBP2-47503]

Immunohistochemistry-Paraffin: CMTM5 Antibody [NBP2-47503]

Immunohistochemistry-Paraffin: CMTM5 Antibody [NBP2-47503] - Staining of human pancreas shows low expression as expected.

Applications for CMTM5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:10 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CMTM5

CMTM5 (CKLF-like MARVEL transmembrane domain-containing protein 5) has at least six variants from alternative splicing, CMTM5-v1 being the predominant form. Research has revealed this is widely expressed in normal tissues, but commonly silenced or down-regulated in cancer cells as a result of promoter methylation. Studies have found that expression of CMTM5-v1 in tumor cells inhibited proliferation and migration, by inducing apoptosis. Therefore, CMTM5 has tumor suppressor activity.

Long Name

CKLF Like MARVEL Transmembrane Domain Containing 5

Alternate Names

CKLFSF5, CMTM 5, FLJ37521

Gene Symbol

CMTM5

Additional CMTM5 Products

Product Documents for CMTM5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CMTM5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CMTM5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CMTM5 Antibody - BSA Free and earn rewards!

Have you used CMTM5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies