COBRA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82924

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all COBRA1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLED

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for COBRA1 Antibody - BSA Free

Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924]

Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924]

Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Analysis in human skin and liver tissues. Corresponding NELFB RNA-seq data are presented for the same tissues.
Western Blot: COBRA1 Antibody [NBP1-82924]

Western Blot: COBRA1 Antibody [NBP1-82924]

Western Blot: COBRA1 Antibody [NBP1-82924] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: COBRA1 Antibody [NBP1-82924]

Immunocytochemistry/ Immunofluorescence: COBRA1 Antibody [NBP1-82924]

Immunocytochemistry/Immunofluorescence: COBRA1 Antibody [NBP1-82924] - Saining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924]

Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924]

Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Western Blot: COBRA1 Antibody [NBP1-82924]

Western Blot: COBRA1 Antibody [NBP1-82924]

Western Blot: COBRA1 Antibody [NBP1-82924] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924]

Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924]

Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924]

Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924]

Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Staining of human liver shows no positivity in hepatocytes.
Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924]

Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924]

Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.
COBRA1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: COBRA1 Antibody - BSA Free [NBP1-82924]

Chromatin Immunoprecipitation-exo-Seq: COBRA1 Antibody - BSA Free [NBP1-82924]

ChIP-Exo-Seq composite graph for Anti-NELFB (NBP1-82924) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for COBRA1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 4 using NBP1-82924 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COBRA1

NELFB is a subunit of negative elongation factor (NELF), which also includes NELFA (WHSC2; MIM 606026), either NELFC or NELFD (TH1L; MIM 605297), and NELFE (RDBP; MIM 154040). NELF acts with DRB sensitivity-inducing factor (DSIF), a heterodimer of SPT4 (SUPT4H1; MIM 603555) and SPT5 (SUPT5H; MIM 602102), to cause transcriptional pausing of RNA polymerase II (see MIM 180660) (Narita et al., 2003 [PubMed 12612062]).[supplied by OMIM]

Alternate Names

cofactor of BRCA1DKFZp586B0519, KIAA1182negative elongation factor B, NELFB, NELF-Bnegative elongation factor protein B

Gene Symbol

COBRA1

Additional COBRA1 Products

Product Documents for COBRA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for COBRA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COBRA1 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used COBRA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: fibroblasts
    Species: Human
    Verified Customer | Posted 09/25/2015
    fibroblasts
    COBRA1 Antibody - BSA Free NBP1-82924

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies