COMP/Thrombospondin-5 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92658

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 20-160 of human COMP (NP_000086.2). GQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for COMP/Thrombospondin-5 Antibody - Azide and BSA Free

Western Blot: COMP/Thrombospondin-5 AntibodyAzide and BSA Free [NBP2-92658]

Western Blot: COMP/Thrombospondin-5 AntibodyAzide and BSA Free [NBP2-92658]

Western Blot: COMP/Thrombospondin-5 Antibody [NBP2-92658] - Western blot analysis of extracts of various cell lines, using COMP/Thrombospondin-5 antibody (NBP2-92658) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: COMP/Thrombospondin-5 AntibodyAzide and BSA Free [NBP2-92658]

Western Blot: COMP/Thrombospondin-5 AntibodyAzide and BSA Free [NBP2-92658]

Western Blot: COMP/Thrombospondin-5 Antibody [NBP2-92658] - Western blot analysis of extracts of various cell lines, using COMP/Thrombospondin-5 antibody (NBP2-92658) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry: COMP/Thrombospondin-5 Antibody - Azide and BSA Free [NBP2-92658]

Immunohistochemistry: COMP/Thrombospondin-5 Antibody - Azide and BSA Free [NBP2-92658]

Immunohistochemistry: COMP/Thrombospondin-5 Antibody [NBP2-92658] - Immunofluorescence analysis of Mouse cartilage using COMP/Thrombospondin-5 Rabbit pAb (NBP2-92658) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
COMP/Thrombospondin-5 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: COMP/Thrombospondin-5 Antibody - Azide and BSA Free [NBP2-92658] -

Immunocytochemistry/ Immunofluorescence: COMP/Thrombospondin-5 Antibody - Azide and BSA Free [NBP2-92658] - Immunofluorescence analysis of Rat cartilage using COMP/Thrombospondin-5 Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Applications for COMP/Thrombospondin-5 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: COMP/Thrombospondin-5

COMP is a noncollagenous extracellular matrix (ECM) protein. It consists of five identical glycoprotein subunits, each with EGF like and calcium binding (thrombospondin like) domains. Oligomerization results from formation of a five stranded coiled coil and disulfides. Binding to other ECM proteins such as collagen appears to depend on divalent cations. Mutations can cause the osteochondrodysplasias pseudochondroplasia (PSACH) and multiple epiphyseal dysplasia (MED)

Long Name

Cartilage Oligomeric Matrix Protein

Alternate Names

EDM1, EPD1, MED, PSACH, Thrombospondin-5, Thrombospondin5

Gene Symbol

COMP

Additional COMP/Thrombospondin-5 Products

Product Documents for COMP/Thrombospondin-5 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for COMP/Thrombospondin-5 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for COMP/Thrombospondin-5 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review COMP/Thrombospondin-5 Antibody - Azide and BSA Free and earn rewards!

Have you used COMP/Thrombospondin-5 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for COMP/Thrombospondin-5 Antibody - Azide and BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I have synovial fluid sample and I want to work on Western bloting can you support me,how can I prepare this sample for WB technique for assay comp(cartilage oligomatrix protein )?

    A:

    We currently sell four antibodies to cartilage oligomeric matrix protein (COMP), all of which are validated for Western blotting. Although we have generated Western blot data using samples from human, bovine and rabbit cartilage, we do not have any testing data derived from synovial fluid samples. You may however find the following publication useful, in which the authors sampled synovial fluid from patients with rheumatoid arthritis and prepared this fluid for Western blot detection of the proteins SP-A and SP-D: PMC 2080374

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...

Associated Pathways

Articular Cartilage Extracellular Matrix
Articular Cartilage Extracellular Matrix Thumbnail