Cortactin Antibody (2W5H9)

Novus Biologicals | Catalog # NBP3-16813

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2W5H9 expressed in HEK293
View all Cortactin Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cortactin (Q14247). MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Cortactin Antibody (2W5H9)

Western Blot: Cortactin Antibody (2W5H9) [NBP3-16813]

Western Blot: Cortactin Antibody (2W5H9) [NBP3-16813]

Western Blot: Cortactin Antibody (2W5H9) [NBP3-16813] - Western blot analysis of extracts of various cell lines, using Cortactin Rabbit mAb (NBP3-16813) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunoprecipitation: Cortactin Antibody (2W5H9) [NBP3-16813]

Immunoprecipitation: Cortactin Antibody (2W5H9) [NBP3-16813]

Immunoprecipitation: Cortactin Antibody (2W5H9) [NBP3-16813] - Immunoprecipitation analysis of 600ug extracts of Mouse lung cells using 3ug Cortactin antibody (NBP3-16813). Western blot was performed from the immunoprecipitate using Cortactin antibody (NBP3-16813) at a dilition of 1:1000.
Cortactin Antibody (2W5H9)

Immunohistochemistry-Paraffin: Cortactin Antibody (2W5H9) [NBP3-16813] -

Immunohistochemistry-Paraffin: Cortactin Antibody (2W5H9) [NBP3-16813] -Human colon tissue using Cortactin Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Cortactin Antibody (2W5H9)

Immunohistochemistry-Paraffin: Cortactin Antibody (2W5H9) [NBP3-16813] -

Immunohistochemistry-Paraffin: Cortactin Antibody (2W5H9) [NBP3-16813] -Confocal imaging of paraffin-embedded Mouse colon tissue using Cortactin Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Cortactin Antibody (2W5H9)

Immunohistochemistry-Paraffin: Cortactin Antibody (2W5H9) [NBP3-16813] -

Immunohistochemistry-Paraffin: Cortactin Antibody (2W5H9) [NBP3-16813] -Confocal imaging of paraffin-embedded Human stomach tissue using Cortactin Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Cortactin Antibody (2W5H9)

Immunocytochemistry/ Immunofluorescence: Cortactin Antibody (2W5H9) [NBP3-16813] -

Immunocytochemistry/ Immunofluorescence: Cortactin Antibody (2W5H9) [NBP3-16813] - Confocal imaging of paraffin-embedded Human stomach tissue using Cortactin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Cortactin Antibody (2W5H9)

Immunocytochemistry/ Immunofluorescence: Cortactin Antibody (2W5H9) [NBP3-16813] -

Immunocytochemistry/ Immunofluorescence: Cortactin Antibody (2W5H9) [NBP3-16813] - Confocal imaging of paraffin-embedded Mouse colon tissue using Cortactin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Applications for Cortactin Antibody (2W5H9)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

0.5μg-4μg antibody for 400μg-600μg extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cortactin

Immunocytochemistry reveals that in epithelial cells, the human cortactin protein is localized mainly in the cytoplasm and, to a very low extent, in protruding leading lamellae of the cell. However, in carcinoma cells that constitutively overexpress cortactin accumulates in the podosome-like adherens junctions associated with the cell-substratum contact sites. Overexpression and concomitant accumulation of the Cortactin protein in the cell-substratum contact sites might, therefore, contribute to the invasive potential of these tumor cells (1). In cells derived from breast carcinomas and squamous carcinomas of the head and neck, DNA amplification of a particular tyrosine kinase substrate region results in overexpression of cortactin. Overexpression is accompanied by a partial redistribution of cortactin from the cytoplasm into cell-matrix contact sites (2).

Alternate Names

Amplaxin, CTTN, EMS1

Gene Symbol

CTTN

Additional Cortactin Products

Product Documents for Cortactin Antibody (2W5H9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cortactin Antibody (2W5H9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cortactin Antibody (2W5H9)

There are currently no reviews for this product. Be the first to review Cortactin Antibody (2W5H9) and earn rewards!

Have you used Cortactin Antibody (2W5H9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies