COX6A1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-92889
![Western Blot: COX6A1 AntibodyBSA Free [NBP2-92889]](https://resources.rndsystems.com/images/products/COX6A1-Antibody-Western-Blot-NBP2-92889-img0006.jpg "Western Blot: COX6A1 AntibodyBSA Free [NBP2-92889]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 25-109 of human COX6A1 (NP_004364.2). SSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for COX6A1 Antibody - BSA Free
Western Blot: COX6A1 AntibodyBSA Free [NBP2-92889]
Western Blot: COX6A1 Antibody [NBP2-92889] - Analysis of extracts of various cell lines, using COX6A1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.![Immunocytochemistry/ Immunofluorescence: COX6A1 Antibody - BSA Free [NBP2-92889]](https://resources.rndsystems.com/images/products/COX6A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92889-img0007.jpg "Immunocytochemistry/ Immunofluorescence: COX6A1 Antibody - BSA Free [NBP2-92889]")
Immunocytochemistry/ Immunofluorescence: COX6A1 Antibody - BSA Free [NBP2-92889]
Immunocytochemistry/Immunofluorescence: COX6A1 Antibody [NBP2-92889] - Immunofluorescence analysis of C6 cells using COX6A1 Polyclonal Antibody (NBP2-92889) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.![Immunohistochemistry-Paraffin: COX6A1 Antibody - BSA Free [NBP2-92889]](https://resources.rndsystems.com/images/products/COX6A1-Antibody-Immunohistochemistry-Paraffin-NBP2-92889-img0005.jpg "Immunohistochemistry-Paraffin: COX6A1 Antibody - BSA Free [NBP2-92889]")
Immunohistochemistry-Paraffin: COX6A1 Antibody - BSA Free [NBP2-92889]
Immunohistochemistry-Paraffin: COX6A1 Antibody [NBP2-92889] - Rat cerebellum using COX6A1 antibody at dilution of 1:100 (40x lens).![Immunocytochemistry/ Immunofluorescence: COX6A1 Antibody - BSA Free [NBP2-92889]](https://resources.rndsystems.com/images/products/COX6A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92889-img0001.jpg "Immunocytochemistry/ Immunofluorescence: COX6A1 Antibody - BSA Free [NBP2-92889]")
Immunocytochemistry/ Immunofluorescence: COX6A1 Antibody - BSA Free [NBP2-92889]
Immunocytochemistry/Immunofluorescence: COX6A1 Antibody [NBP2-92889] - Analysis of NIH-3T3 cells using COX6A1. Blue: DAPI for nuclear staining.![Immunocytochemistry/ Immunofluorescence: COX6A1 Antibody - BSA Free [NBP2-92889]](https://resources.rndsystems.com/images/products/COX6A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92889-img0002.jpg "Immunocytochemistry/ Immunofluorescence: COX6A1 Antibody - BSA Free [NBP2-92889]")
Immunocytochemistry/ Immunofluorescence: COX6A1 Antibody - BSA Free [NBP2-92889]
Immunocytochemistry/Immunofluorescence: COX6A1 Antibody [NBP2-92889] - Analysis of U-2 OS cells using COX6A1. Blue: DAPI for nuclear staining.![Immunohistochemistry-Paraffin: COX6A1 Antibody - BSA Free [NBP2-92889]](https://resources.rndsystems.com/images/products/COX6A1-Antibody-Immunohistochemistry-Paraffin-NBP2-92889-img0003.jpg "Immunohistochemistry-Paraffin: COX6A1 Antibody - BSA Free [NBP2-92889]")
Immunohistochemistry-Paraffin: COX6A1 Antibody - BSA Free [NBP2-92889]
Immunohistochemistry-Paraffin: COX6A1 Antibody [NBP2-92889] - Human liver cancer using COX6A1 antibody at dilution of 1:100 (40x lens).![Immunohistochemistry-Paraffin: COX6A1 Antibody - BSA Free [NBP2-92889]](https://resources.rndsystems.com/images/products/COX6A1-Antibody-Immunohistochemistry-Paraffin-NBP2-92889-img0004.jpg "Immunohistochemistry-Paraffin: COX6A1 Antibody - BSA Free [NBP2-92889]")
Immunohistochemistry-Paraffin: COX6A1 Antibody - BSA Free [NBP2-92889]
Immunohistochemistry-Paraffin: COX6A1 Antibody [NBP2-92889] - Mouse liver using COX6A1 antibody at dilution of 1:100 (40x lens).Applications for COX6A1 Antibody - BSA Free
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL.
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:20-1:200
Western Blot
1:200-1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: COX6A1
Alternate Names
COX VIa-L, COX6A, COX6AL, Cytochrome c oxidase polypeptide VIa-liver, cytochrome c oxidase subunit 6A1, mitochondrial, cytochrome C oxidase subunit VIa homolog, cytochrome c oxidase subunit VIa polypeptide 1, Cytochrome c oxidase subunit VIA-liver, MGC104500
Gene Symbol
COX6A1
Additional COX6A1 Products
Product Documents for COX6A1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for COX6A1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for COX6A1 Antibody - BSA Free
Powered by Bioz
Customer Reviews for COX6A1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review COX6A1 Antibody - BSA Free and earn rewards!
Have you used COX6A1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...