CS Citrate Synthase Antibody (4Z10Z8)

Novus Biologicals | Catalog # NBP3-16438

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4Z10Z8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 367-466 of human CS Citrate Synthase (O75390). HLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CS Citrate Synthase Antibody (4Z10Z8)

Western Blot: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438]

Western Blot: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438]

Western Blot: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] - Western blot analysis of extracts of Rat heart cells, using CS Citrate Synthase antibody (NBP3-16438) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunocytochemistry/ Immunofluorescence: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438]

Immunocytochemistry/ Immunofluorescence: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438]

Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] - Immunofluorescence analysis of NIH-3T3 cells using CS Citrate Synthase Rabbit mAb (NBP3-16438) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
CS Citrate Synthase Antibody (4Z10Z8)

Immunohistochemistry: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] -

Immunohistochemistry: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] - Immunohistochemistry analysis of CS Citrate Synthase in paraffin-embedded mouse kidney tissue using CS Citrate Synthase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CS Citrate Synthase Antibody (4Z10Z8)

Immunohistochemistry: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] -

Immunohistochemistry: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] - Immunohistochemistry analysis of CS Citrate Synthase in paraffin-embedded rat colon tissue using CS Citrate Synthase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CS Citrate Synthase Antibody (4Z10Z8)

Immunohistochemistry: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] -

Immunohistochemistry: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] - Immunohistochemistry analysis of CS Citrate Synthase in paraffin-embedded rat liver tissue using CS Citrate Synthase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CS Citrate Synthase Antibody (4Z10Z8)

Immunohistochemistry: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] -

Immunohistochemistry: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] - Immunohistochemistry analysis of CS Citrate Synthase in paraffin-embedded human colon carcinoma tissue using CS Citrate Synthase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for CS Citrate Synthase Antibody (4Z10Z8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CS Citrate Synthase

The protein encoded by the CS Citrate Synthase gene is a Krebs tricarboxylic acid cycle enzyme that catalyzes the synthesis of citratefrom oxaloacetate and acetyl coenzyme A. The enzyme is found in nearly all cells capable of oxidative metablism. Thisprotein is nuclear encoded and transported into the mitochondrial matrix, where the mature form is found. (provided byRefSeq)

Long Name

CS Citrate Synthase

Alternate Names

citrate (Si)-synthase, citrate synthase, mitochondrial, EC 2.3.3.1

Gene Symbol

CS

Additional CS Citrate Synthase Products

Product Documents for CS Citrate Synthase Antibody (4Z10Z8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CS Citrate Synthase Antibody (4Z10Z8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CS Citrate Synthase Antibody (4Z10Z8)

There are currently no reviews for this product. Be the first to review CS Citrate Synthase Antibody (4Z10Z8) and earn rewards!

Have you used CS Citrate Synthase Antibody (4Z10Z8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...