CTCF Antibody (4W9B0)
Novus Biologicals | Catalog # NBP3-15795
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Chromatin Immunoprecipitation (ChIP), Chromatin Immunoprecipitation Sequencing
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 4W9B0 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 628-727 of human CTCF (P49711). PAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEMILSMMDR
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for CTCF Antibody (4W9B0)
Western Blot: CTCF Antibody (4W9B0) [NBP3-15795]
Western Blot: CTCF Antibody (4W9B0) [NBP3-15795] - Western blot analysis of extracts of various cell lines, using CTCF antibody (NBP3-15795) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Immunocytochemistry/ Immunofluorescence: CTCF Antibody (4W9B0) [NBP3-15795]
Immunocytochemistry/Immunofluorescence: CTCF Antibody (4W9B0) [NBP3-15795] - Immunofluorescence analysis of NIH-3T3 cells using CTCF antibody (NBP3-15795). Blue: DAPI for nuclear staining.
Chromatin Immunoprecipitation: CTCF Antibody (4W9B0) [NBP3-15795] - Chromatin immunoprecipitation analysis of extracts of 293T cells, using CTCF antibody (NBP3-15795) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Immunocytochemistry/ Immunofluorescence: CTCF Antibody (4W9B0) [NBP3-15795]
Immunocytochemistry/Immunofluorescence: CTCF Antibody (4W9B0) [NBP3-15795] - Immunofluorescence analysis of C6 cells using CTCF antibody (NBP3-15795). Blue: DAPI for nuclear staining.Immunoprecipitation: CTCF Antibody (4W9B0) [NBP3-15795]
Immunoprecipitation: CTCF Antibody (4W9B0) [NBP3-15795] - Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug CTCF antibody (NBP3-15795). Western blot was performed from the immunoprecipitate using CTCF antibody (NBP3-15795) at a dilition of 1:1000.Applications for CTCF Antibody (4W9B0)
Application
Recommended Usage
Chromatin Immunoprecipitation (ChIP)
3μg antibody for 10 ug-15 ug of chromatin
Chromatin Immunoprecipitation Sequencing
1:50 - 1:100
ELISA
Recommended starting concentration is 1 ug/mL
Immunocytochemistry/ Immunofluorescence
1:200 - 1:800
Immunoprecipitation
0.5μg-4μg antibody for 200 ug-400 ug extracts of whole cells
Western Blot
1:1000 - 1:4000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.09% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: CTCF
Long Name
CCCTC-binding Factor
Alternate Names
11-Zinc Finger Protein2, CCCTC-binding Factor
Gene Symbol
CTCF
Additional CTCF Products
Product Documents for CTCF Antibody (4W9B0)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CTCF Antibody (4W9B0)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for CTCF Antibody (4W9B0)
There are currently no reviews for this product. Be the first to review CTCF Antibody (4W9B0) and earn rewards!
Have you used CTCF Antibody (4W9B0)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ChIP Protocol Video
- Chromatin Immunoprecipitation (ChIP) Protocol
- Chromatin Immunoprecipitation Protocol
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...