CYP51A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35348

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CYP51A1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 245-420 of CYP51A1 (NP_000777.1).

Sequence:
WLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPIMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CYP51A1 Antibody - BSA Free

CYP51A1 Antibody

Immunocytochemistry/ Immunofluorescence: CYP51A1 Antibody [NBP3-35348] -

Immunocytochemistry/ Immunofluorescence: CYP51A1 Antibody [NBP3-35348] - Immunofluorescence analysis of L929 cells using CYP51A1 Rabbit pAb at dilution of 100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
CYP51A1 Antibody

Immunohistochemistry: CYP51A1 Antibody [NBP3-35348] -

Immunohistochemistry: CYP51A1 Antibody [NBP3-35348] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using CYP51A1 Rabbit pAb at dilution of 1:50 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
CYP51A1 Antibody

Immunohistochemistry: CYP51A1 Antibody [NBP3-35348] -

Immunohistochemistry: CYP51A1 Antibody [NBP3-35348] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using CYP51A1 Rabbit pAb at dilution of 1:50 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
CYP51A1 Antibody

Western Blot: CYP51A1 Antibody [NBP3-35348] -

Western Blot: CYP51A1 Antibody [NBP3-35348] - Western blot analysis of various lysates using CYP51A1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
CYP51A1 Antibody

Immunohistochemistry: CYP51A1 Antibody [NBP3-35348] -

Immunohistochemistry: CYP51A1 Antibody [NBP3-35348] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using CYP51A1 Rabbit pAb at dilution of 1:50 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for CYP51A1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CYP51A1

CYP51A1, also known as Lanosterol 14-alpha demethylase, consists of a 56.8 kDa and a 46.3 kDa isoform and is involved in transforming lanosterol by removing the 14alpha-methyl group. Current research is being conducted with several diseases including tuberculosis, antley-bixler syndrome, colorectal cancer, leukemia, immunodeficiency, prostatitis, cholesterol, and chagas disease. This protein has been linked to the cholesterol and steroid biosynthesis, metabolism, and signaling pathways, where it interacts with FA2H, MSMO1, SCD, ZMPSTE24, and FDFT1.

Long Name

Lanosterol 14-alpha demethylase

Alternate Names

CYP51, CYPLI, Cytochrome P45014DM, Cytochrome P450LI, EC 1.14.14.154, LDM

Gene Symbol

CYP51A1

Additional CYP51A1 Products

Product Documents for CYP51A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CYP51A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CYP51A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CYP51A1 Antibody - BSA Free and earn rewards!

Have you used CYP51A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies