Cystatin B/Stefin B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85430

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cystatin B/Stefin B Antibody - BSA Free

Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430]

Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430]

Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430] - Analysis in human cell lines A-431 and U-251MG using anti-CSTB antibody. Corresponding CSTB RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunocytochemistry/ Immunofluorescence: Cystatin B/Stefin B Antibody [NBP1-85430]

Immunocytochemistry/ Immunofluorescence: Cystatin B/Stefin B Antibody [NBP1-85430]

Immunocytochemistry/Immunofluorescence: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430]

Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430]

Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-557
Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430]

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430]

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Analysis in human esophagus and skeletal muscle tissues. Corresponding Cystatin B/Stefin B RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430]

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430]

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human esophagus shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430]

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430]

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human liver shows no positivity in hepatocytes.as expected.
Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430]

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430]

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human tonsil shows moderate to strong nuclear and cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430]

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430]

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for Cystatin B/Stefin B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cystatin B

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1).

Alternate Names

CSTB, Stefin B

Gene Symbol

CSTB

Additional Cystatin B Products

Product Documents for Cystatin B/Stefin B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cystatin B/Stefin B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Cystatin B/Stefin B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cystatin B/Stefin B Antibody - BSA Free and earn rewards!

Have you used Cystatin B/Stefin B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...