Cytochrome b5 type A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49284

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Cited:

Immunohistochemistry, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cytochrome b5 type A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLAEHPGG

Reactivity Notes

Mouse (85%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cytochrome b5 type A Antibody - BSA Free

Cytochrome b5 type A Antibody - BSA Free

Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] -

Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] - Analysis in human liver and skeletal muscle tissues using NBP2-49284 antibody. Corresponding CYB5A RNA-seq data are presented for the same tissues.
Western Blot: Cytochrome b5 type A Antibody [NBP2-49284]

Western Blot: Cytochrome b5 type A Antibody [NBP2-49284]

Western Blot: Cytochrome b5 type A Antibody [NBP2-49284] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Lane 4: Human plasma
Lane 5: Human Liver tissue
Lane 6: Human Tonsil tissue
Immunocytochemistry/ Immunofluorescence: Cytochrome b5 type A Antibody [NBP2-49284]

Immunocytochemistry/ Immunofluorescence: Cytochrome b5 type A Antibody [NBP2-49284]

Immunocytochemistry/Immunofluorescence: Cytochrome b5 type A Antibody [NBP2-49284] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284]

Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284]

Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] - Staining of human liver shows high expression.
Cytochrome b5 type A Antibody - BSA Free

Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] -

Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] -Staining of human Testis shows strong cytoplasmic positivity in Leydig cells.
Cytochrome b5 type A Antibody - BSA Free

Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] -

Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] -Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.
Cytochrome b5 type A Antibody - BSA Free

Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] -

Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] -Staining of human Kidney shows strong cytoplasmic positivity in cells in tubules.

Applications for Cytochrome b5 type A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Simple Western

1:20

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Tested in Testes, separated by Size, antibody dilution of 1:20, apparent MW was 20 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytochrome b5 type A

Alternate Names

CYB5, cytochrome b-5, cytochrome b5 (microsomal), cytochrome b5 type A (microsomal), MCB5cytochrome b5, Microsomal cytochrome b5 type A, type 1 cyt-b5

Gene Symbol

CYB5A

Additional Cytochrome b5 type A Products

Product Documents for Cytochrome b5 type A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cytochrome b5 type A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Cytochrome b5 type A Antibody - BSA Free

Customer Reviews for Cytochrome b5 type A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytochrome b5 type A Antibody - BSA Free and earn rewards!

Have you used Cytochrome b5 type A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies