Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) - Azide and BSA Free

Novus Biologicals | Catalog # H00001345-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 4G4-2A8

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

COX6C (AAH00187, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK

Specificity

COX6C - cytochrome c oxidase subunit VIc

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images

Immunocytochemistry/ Immunofluorescence: Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) [H00001345-M01]

Immunocytochemistry/ Immunofluorescence: Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) [H00001345-M01]

Immunocytochemistry/Immunofluorescence: Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) [H00001345-M01] - Analysis of monoclonal antibody to COX6C on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) [H00001345-M01]

Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) [H00001345-M01]

Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) [H00001345-M01] - Analysis of monoclonal antibody to COX6C on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) [H00001345-M01]

Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) [H00001345-M01]

Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) [H00001345-M01] - Immunoperoxidase of monoclonal antibody to COX6C ( Cat # H00001345-M01 ) on formalin-fixed paraffin-embedded human thyroid nodular goiter tissue.

Applications

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Cytochrome C Oxidase subunit 6c

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse COX subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene COX6CP1 has been found on chromosomes 16p12.

Alternate Names

Cytochrome c oxidase polypeptide VIc, cytochrome c oxidase subunit 6C, cytochrome c oxidase subunit VIc, cytochrome c oxidase subunit VIc preprotein

Entrez Gene IDs

1345 (Human)

Gene Symbol

COX6C

OMIM

124090 (Human)

Additional Cytochrome C Oxidase subunit 6c Products

Product Documents

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews

There are currently no reviews for this product. Be the first to review Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) - Azide and BSA Free and earn rewards!

Have you used Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...