DDX21 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38311

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DDX21 Antibody - BSA Free

Western Blot: DDX21 Antibody [NBP2-38311]

Western Blot: DDX21 Antibody [NBP2-38311]

Western Blot: DDX21 Antibody [NBP2-38311] - Analysis using Anti-DDX21 antibody NBP2-38311 (A) shows similar pattern to independent antibody NBP1-83310 (B).
Immunocytochemistry/ Immunofluorescence: DDX21 Antibody [NBP2-38311]

Immunocytochemistry/ Immunofluorescence: DDX21 Antibody [NBP2-38311]

Immunocytochemistry/Immunofluorescence: DDX21 Antibody [NBP2-38311] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311]

Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311]

Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Staining of human appendix shows strong positivity in nucleoli in lymphoid tissue.
Western Blot: DDX21 Antibody [NBP2-38311]

Western Blot: DDX21 Antibody [NBP2-38311]

Western Blot: DDX21 Antibody [NBP2-38311] - Western blot analysis in human cell lines Caco-2 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311]

Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311]

Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311]

Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311]

Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311]

Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311]

Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Analysis in human appendix and skeletal muscle tissues using NBP2-38311 antibody. Corresponding DDX21 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311]

Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311]

Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Staining of human skeletal muscle shows no positivity in nucleoli in myocytes as expected.

Applications for DDX21 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

1:100 - 1:250
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DDX21

DDX21 is a member of the DEAD box family of proteins that possesses several conserved motifs which include the highly conserved DEAD (Asp-Glu-Ala-Asp) amino acid sequence motif. The major activity of DEAD box proteins is to function as ATP-dependent RNA helicases. As helicases, DEAD proteins play an important role in all aspects of RNA metabolism and function which include pre-mRNA splicing, RNA synthesis, RNA degradation, RNA export, RNA translation, RNA secondary structure formation, ribosome biogenesis, and the assembly of RNP complexes. Some members of the DEAD box proteins also exhibit functions involved in transcriptional regulation. DDX21 has been shown to be required for the processing of 20S rRNA to 18S and has also been shown to be important for c-Jun transcriptional activation.

Alternate Names

DEAD (Asp-Glu-Ala-Asp) box polypeptide 21, DEAD box protein 21, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21, DKFZp686F21172, EC 3.6.1, EC 3.6.4.13, Gu protein, GUA, Gu-alpha, GURDB, nucleolar RNA helicase 2, Nucleolar RNA helicase Gu, Nucleolar RNA helicase II, RH II/Gu, RH-II/GU, RH-II/GuA, RNA helicase II/Gu alpha

Gene Symbol

DDX21

UniProt

Additional DDX21 Products

Product Documents for DDX21 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DDX21 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDX21 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDX21 Antibody - BSA Free and earn rewards!

Have you used DDX21 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...