DDX5 Antibody (1K6X10)

Novus Biologicals | Catalog # NBP3-15371

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1K6X10 expressed in HEK293
View all DDX5 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDX5 (P17844). MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEAN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DDX5 Antibody (1K6X10)

Western Blot: DDX5 Antibody (1K6X10) [NBP3-15371]

Western Blot: DDX5 Antibody (1K6X10) [NBP3-15371]

Western Blot: DDX5 Antibody (1K6X10) [NBP3-15371] - Western blot analysis of extracts of various cell lines, using DDX5 Rabbit mAb (NBP3-15371) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371]

Immunocytochemistry/ Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371]

Immunocytochemistry/Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunofluorescence analysis of NIH-3T3 cells using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371]

Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371]

Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunohistochemistry of paraffin-embedded mouse spinal cord using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371]

Immunocytochemistry/ Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371]

Immunocytochemistry/Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunofluorescence analysis of C6 cells using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371]

Immunocytochemistry/ Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371]

Immunocytochemistry/Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunofluorescence analysis of HeLa cells using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371]

Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371]

Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunohistochemistry of paraffin-embedded rat ovary using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371]

Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371]

Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunohistochemistry of paraffin-embedded human esophageal using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunoprecipitation: DDX5 Antibody (1K6X10) [NBP3-15371]

Immunoprecipitation: DDX5 Antibody (1K6X10) [NBP3-15371]

Immunoprecipitation: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunoprecipitation analysis of 600ug extracts of Mouse testis using 3ug DDX5 antibody (NBP3-15371). Western blot was performed from the immunoprecipitate using DDX5 (NBP3-15371) at a dilition of 1:1000.
DDX5 Antibody (1K6X10)

Immunocytochemistry/ Immunofluorescence: DDX5 Antibody (1K6X10) [DDX5] -

Immunocytochemistry/ Immunofluorescence: DDX5 Antibody (1K6X10) [DDX5] - Confocal imaging of Hep G2 cells using DDX5 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo " + "488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
DDX5 Antibody (1K6X10)

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] -

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
DDX5 Antibody (1K6X10)

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] -

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
DDX5 Antibody (1K6X10)

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] -

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
DDX5 Antibody (1K6X10)

Immunocytochemistry/ Immunofluorescence: DDX5 Antibody (1K6X10) [DDX5] -

Immunocytochemistry/ Immunofluorescence: DDX5 Antibody (1K6X10) [DDX5] - Confocal imaging of C2C12 cells using DDX5 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
DDX5 Antibody (1K6X10)

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] -

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
DDX5 Antibody (1K6X10)

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] -

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
DDX5 Antibody (1K6X10)

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] -

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
DDX5 Antibody (1K6X10)

Immunocytochemistry/ Immunofluorescence: DDX5 Antibody (1K6X10) [DDX5] -

Immunocytochemistry/ Immunofluorescence: DDX5 Antibody (1K6X10) [DDX5] - Confocal imaging of U-2 OS cells using DDX5 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
DDX5 Antibody (1K6X10)

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] -

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
DDX5 Antibody (1K6X10)

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] -

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
DDX5 Antibody (1K6X10)

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] -

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
DDX5 Antibody (1K6X10)

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] -

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
DDX5 Antibody (1K6X10)

Western Blot: DDX5 Antibody (1K6X10) [DDX5] -

Western Blot: DDX5 Antibody (1K6X10) [DDX5] - Western blot analysis of various lysates using DDX5 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
DDX5 Antibody (1K6X10)

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] -

Immunohistochemistry: DDX5 Antibody (1K6X10) [DDX5] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using DDX5 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for DDX5 Antibody (1K6X10)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DDX5

DDX5, also known as Probable ATP-dependent RNA helicase DDX5, is a 69.1 kDa, 613 amino acid protein that regulates pre-mRNA splicing by increasing the inclusion of tau exon 10. Current research with the protein is being conducted for diseases and disorders such as squamous cell carcinoma, breast cancer, fibrosis, prostate cancer, hepatitis, malaria, and myeloma. The protein interacts in translational control and spliceosome pathways with HIST1H4A- HIST1H4E proteins.

Long Name

DEAD Box Protein 5

Alternate Names

DEAD/H, G17P1, HELR, HLR1, HUMP68

Gene Symbol

DDX5

Additional DDX5 Products

Product Documents for DDX5 Antibody (1K6X10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DDX5 Antibody (1K6X10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDX5 Antibody (1K6X10)

There are currently no reviews for this product. Be the first to review DDX5 Antibody (1K6X10) and earn rewards!

Have you used DDX5 Antibody (1K6X10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies