DDX50 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38571

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DDX50 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human DDX50 (NP_076950.1).

Sequence:
MPGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHKSSDNKLEETLTREQK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DDX50 Antibody - BSA Free

DDX50 Antibody

Immunocytochemistry/ Immunofluorescence: DDX50 Antibody [NBP3-38571] -

Immunocytochemistry/ Immunofluorescence: DDX50 Antibody [NBP3-38571] - Immunofluorescence analysis of C6 cells using DDX50 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
DDX50 Antibody

Western Blot: DDX50 Antibody [NBP3-38571] -

Western Blot: DDX50 Antibody [NBP3-38571] - Western blot analysis of various lysates using DDX50 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
DDX50 Antibody

Immunohistochemistry: DDX50 Antibody [NBP3-38571] -

Immunohistochemistry: DDX50 Antibody [NBP3-38571] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using DDX50 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
DDX50 Antibody

Immunocytochemistry/ Immunofluorescence: DDX50 Antibody [NBP3-38571] -

Immunocytochemistry/ Immunofluorescence: DDX50 Antibody [NBP3-38571] - Immunofluorescence analysis of U-2 OS cells using DDX50 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
DDX50 Antibody

Immunohistochemistry: DDX50 Antibody [NBP3-38571] -

Immunohistochemistry: DDX50 Antibody [NBP3-38571] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using DDX50 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
DDX50 Antibody

Immunocytochemistry/ Immunofluorescence: DDX50 Antibody [NBP3-38571] -

Immunocytochemistry/ Immunofluorescence: DDX50 Antibody [NBP3-38571] - Immunofluorescence analysis of NIH-3T3 cells using DDX50 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for DDX50 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:200 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DDX50

DDX50, also known as ATP-dependent RNA helicase DDX50, is an 82.6 kDa 737 amino acid protein and is involved in cellular growth and division as a member of the DEAD box protein family. The protein is being studied for involvement in malaria. While involved in ATP and RNA binding pathways, the protein interacts with other proteins such as MED19, SRRM2, UBC, ESR2, and STAU1.

Alternate Names

ATP-dependent RNA helicase DDX50, DEAD (Asp-Glu-Ala-Asp) box polypeptide 50, DEAD box protein 50, EC 3.6.1, EC 3.6.4.13, GU2, GUB, gu-beta, MGC3199, Nucleolar protein Gu2, RH-II/GuB, RNA helicase II/Gu beta

Gene Symbol

DDX50

Additional DDX50 Products

Product Documents for DDX50 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DDX50 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDX50 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDX50 Antibody - BSA Free and earn rewards!

Have you used DDX50 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies