Dihydrolipoamide Dehydrogenase/DLD Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13926

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Dihydrolipoamide Dehydrogenase/DLD Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: DVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Dihydrolipoamide Dehydrogenase/DLD Antibody - BSA Free

Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926]

Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926]

Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926]

Immunocytochemistry/ Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926]

Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926]

Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926]

Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Staining of human kidney shows high expression.
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926]

Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926]

Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926]

Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926]

Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Staining of human epididymis shows low expression as expected.
Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926]

Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926]

Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Staining in human kidney and epididymis tissues using anti-DLD antibody. Corresponding DLD RNA-seq data are presented for the same tissues.

Applications for Dihydrolipoamide Dehydrogenase/DLD Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Dihydrolipoamide Dehydrogenase/DLD

Lipoamide Dehydrogenase encodes the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.

Alternate Names

Diaphorase, DLD, DLDD, DLDH, GCSL, LAD, Lipoamide Dehydrogenase, PHE3

Gene Symbol

DLD

Additional Dihydrolipoamide Dehydrogenase/DLD Products

Product Documents for Dihydrolipoamide Dehydrogenase/DLD Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Dihydrolipoamide Dehydrogenase/DLD Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Redox Enzymes

Customer Reviews for Dihydrolipoamide Dehydrogenase/DLD Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dihydrolipoamide Dehydrogenase/DLD Antibody - BSA Free and earn rewards!

Have you used Dihydrolipoamide Dehydrogenase/DLD Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies