DjC9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87903

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DjC9 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DjC9 Antibody [NBP1-87903]

Immunocytochemistry/ Immunofluorescence: DjC9 Antibody [NBP1-87903]

Immunocytochemistry/Immunofluorescence: DjC9 Antibody [NBP1-87903] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & plasma membrane.
Western Blot: DjC9 Antibody [NBP1-87903]

Western Blot: DjC9 Antibody [NBP1-87903]

Western Blot: DjC9 Antibody [NBP1-87903] - Analysis using Anti-DNAJC9 antibody NBP1-87903 (A) shows similar pattern to independent antibody NBP2-33997 (B).
DjC9 Antibody - BSA Free Western Blot: DjC9 Antibody - BSA Free [NBP1-87903]

Western Blot: DjC9 Antibody - BSA Free [NBP1-87903]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
DjC9 Antibody - BSA Free Immunohistochemistry-Paraffin: DjC9 Antibody - BSA Free [NBP1-87903]

Immunohistochemistry-Paraffin: DjC9 Antibody - BSA Free [NBP1-87903]

Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
DjC9 Antibody - BSA Free Immunohistochemistry-Paraffin: DjC9 Antibody - BSA Free [NBP1-87903]

Immunohistochemistry-Paraffin: DjC9 Antibody - BSA Free [NBP1-87903]

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
DjC9 Antibody - BSA Free Immunohistochemistry-Paraffin: DjC9 Antibody - BSA Free [NBP1-87903]

Immunohistochemistry-Paraffin: DjC9 Antibody - BSA Free [NBP1-87903]

Staining of human placenta shows strong nuclear-cytoplasmic positivity in decidual cells and trophoblastic cells.
DjC9 Antibody - BSA Free Immunohistochemistry-Paraffin: DjC9 Antibody - BSA Free [NBP1-87903]

Immunohistochemistry-Paraffin: DjC9 Antibody - BSA Free [NBP1-87903]

Staining of human tonsil shows strong nuclear positivity in non-germinal center cells and germinal center cells.

Applications for DjC9 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DjC9

DjC9 (DnaJ subfamily C member 9) belongs to the Hsp40 (heat shock protein 40) family of proteins that function as co-chaperones to Hsp70.Hsp40 proteins are classified into 3 main subfamilies (A, B, and C). The families are defined by the presence of particular domains which include a highly conserved alpha-helical N-terminal domain termed the J-domain, a glycine/phenylalanine-rich region, a cysteine-rich region, and a C-terminal beta-sheet containing domain. DjC9 is part of subfamily C that bears only the J-domain. DjC9 has been shown to interact with HSP70 through its J domain and activate its ATPase activity. DjC9 is also known as DnaJ protein SB73, HDJC9,DNAJC9,JDD1, and KIAA0974.

Alternate Names

DnaJ (Hsp40) homolog, subfamily C, member 9, dnaJ homolog subfamily C member 9

Gene Symbol

DNAJC9

Additional DjC9 Products

Product Documents for DjC9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DjC9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DjC9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DjC9 Antibody - BSA Free and earn rewards!

Have you used DjC9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...