DNA Ligase I Antibody (0D6M4)

Novus Biologicals | Catalog # NBP3-33540

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 0D6M4
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human DNA Ligase I (P18858).

Sequence:
MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKAARVLGSEGEEEDEALSPAKGQKPALDCSQVS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

102 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DNA Ligase I Antibody (0D6M4)

DNA Ligase I Antibody (0D6M4)

Western Blot: DNA Ligase I Antibody (0D6M4) [NBP3-33540] -

Western Blot: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Western blot analysis of lysates from Jurkat cells, using DNA Ligase I Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
DNA Ligase I Antibody (0D6M4)

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] -

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Immunohistochemistry analysis of DNA Ligase I in paraffin-embedded human colon carcinoma tissue using DNA Ligase I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
DNA Ligase I Antibody (0D6M4)

Immunocytochemistry/ Immunofluorescence: DNA Ligase I Antibody (0D6M4) [NBP3-33540] -

Immunocytochemistry/ Immunofluorescence: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Immunofluorescence analysis of C6 cells using DNA Ligase I Rabbit mAb (A9301) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
DNA Ligase I Antibody (0D6M4)

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] -

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Immunohistochemistry analysis of DNA Ligase I in paraffin-embedded rat lung tissue using DNA Ligase I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
DNA Ligase I Antibody (0D6M4)

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] -

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Immunohistochemistry analysis of DNA Ligase I in paraffin-embedded rat brain tissue using DNA Ligase I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
DNA Ligase I Antibody (0D6M4)

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] -

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Immunohistochemistry analysis of DNA Ligase I in paraffin-embedded human thyroid cancer tissue using DNA Ligase I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
DNA Ligase I Antibody (0D6M4)

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] -

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Immunohistochemistry analysis of DNA Ligase I in paraffin-embedded human spleen tissue using DNA Ligase I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
DNA Ligase I Antibody (0D6M4)

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] -

Immunohistochemistry: DNA Ligase I Antibody (0D6M4) [NBP3-33540] - Immunohistochemistry analysis of DNA Ligase I in paraffin-embedded mouse brain tissue using DNA Ligase I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for DNA Ligase I Antibody (0D6M4)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DNA Ligase I

DNA ligase 1 catalyzes the joining of double-stranded DNA ends during replication, recombination, and repair. Structurally, DNA ligase 1 is toroidal and encircles nicked DNA substrates. The 9-1-1 complex, a DNA damage checkpoint complex, has been reported to associate with DNA ligase 1 and stimulate ligase activity. Mutations in DNA ligase 1 result in immunodeficiency and increased sensitivity to DNA-damaging agents.

Long Name

DNA ligase 1

Alternate Names

EC 6.5.1.1

Gene Symbol

LIG1

Additional DNA Ligase I Products

Product Documents for DNA Ligase I Antibody (0D6M4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNA Ligase I Antibody (0D6M4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNA Ligase I Antibody (0D6M4)

There are currently no reviews for this product. Be the first to review DNA Ligase I Antibody (0D6M4) and earn rewards!

Have you used DNA Ligase I Antibody (0D6M4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...