DNA Ligase III Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92719

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DNA Ligase III Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 254-460 of human DNA Ligase III (NP_039269.2). CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

113 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DNA Ligase III Antibody - BSA Free

Western Blot: DNA Ligase III AntibodyAzide and BSA Free [NBP2-92719]

Western Blot: DNA Ligase III AntibodyAzide and BSA Free [NBP2-92719]

Western Blot: DNA Ligase III Antibody [NBP2-92719] - Analysis of extracts of various cell lines, using at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunocytochemistry/ Immunofluorescence: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719]

Immunocytochemistry/ Immunofluorescence: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719]

Immunocytochemistry/Immunofluorescence: DNA Ligase III Antibody [NBP2-92719] - Analysis of PC-12 cells using LIG3 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719]

Immunocytochemistry/ Immunofluorescence: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719]

Immunocytochemistry/Immunofluorescence: DNA Ligase III Antibody [NBP2-92719] - Analysis of NIH/3T3 cells using LIG3 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
DNA Ligase III Antibody - Azide and BSA Free

Immunohistochemistry: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719] -

Immunohistochemistry: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719] - Immunohistochemistry analysis of paraffin-embedded Rat liver using DNA Ligase III Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
DNA Ligase III Antibody - Azide and BSA Free

Immunohistochemistry: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719] -

Immunohistochemistry: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719] - Immunohistochemistry analysis of paraffin-embedded Rat ovary using DNA Ligase III Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
DNA Ligase III Antibody - Azide and BSA Free

Immunohistochemistry: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719] -

Immunohistochemistry: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using DNA Ligase III Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
DNA Ligase III Antibody - Azide and BSA Free

Immunohistochemistry: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719] -

Immunohistochemistry: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719] - Immunohistochemistry analysis of paraffin-embedded Rat brain using DNA Ligase III Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for DNA Ligase III Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DNA Ligase III

DNA Ligase III is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and is located in both the mitochondria and nucleus, with translation initiation from the upstream start codon allowing for transport to the mitochondria and translation initiation from a downstream start codon allowing for transport to the nucleus. Additionally, alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Long Name

DNA ligase 3

Alternate Names

LIG3

Gene Symbol

LIG3

Additional DNA Ligase III Products

Product Documents for DNA Ligase III Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DNA Ligase III Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNA Ligase III Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNA Ligase III Antibody - BSA Free and earn rewards!

Have you used DNA Ligase III Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies