DNA Polymerase beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38600

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: YCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DNA Polymerase beta Antibody - BSA Free

Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600]

Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600]

Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600] - Staining in human testis and liver tissues using anti-POLB antibody. Corresponding POLB RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: DNA Polymerase beta Antibody [NBP2-38600]

Immunocytochemistry/ Immunofluorescence: DNA Polymerase beta Antibody [NBP2-38600]

Immunocytochemistry/Immunofluorescence: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600]

Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600]

Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human liver shows low expression as expected.
Immunohistochemistry: DNA Polymerase beta Antibody [NBP2-38600]

Immunohistochemistry: DNA Polymerase beta Antibody [NBP2-38600]

Immunohistochemistry: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
DNA Polymerase beta Antibody - BSA Free

DNA Polymerase beta Antibody [NBP2-38600] -

Analysis in human cell line MOLT-4.
DNA Polymerase beta Antibody - BSA Free

DNA Polymerase beta Antibody [NBP2-38600] -

Staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.
DNA Polymerase beta Antibody - BSA Free

DNA Polymerase beta Antibody [NBP2-38600] -

Staining of human prostate shows moderate nuclear positivity in glandular cells.
DNA Polymerase beta Antibody - BSA Free

DNA Polymerase beta Antibody [NBP2-38600] -

Staining of human colon shows no positivity in glandular cells as expected.

Applications for DNA Polymerase beta Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 5 using NBP2-38600 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNA Polymerase beta

DNA polymerase beta comprises an amino terminal 8kDa domain and a carboxy terminal 31kDa domain. DNA Polymerase beta, a DNA repair polymerase is constitutively expressed in cultured cells. DNA polymerase beta fills single nucleotide gaps in DNA produced by the base excision repair pathway of mammalian cells.

Alternate Names

POLB

Gene Symbol

POLB

UniProt

Additional DNA Polymerase beta Products

Product Documents for DNA Polymerase beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNA Polymerase beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for DNA Polymerase beta Antibody - BSA Free

Customer Reviews for DNA Polymerase beta Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used DNA Polymerase beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • DNA Polymerase beta Antibody
    Name: Meiyi Tang
    Application: Slot blot DPC assay
    Sample Tested: Genomic DNA samples from LN428 cells -treated by copper complex to induce DNA-protein cross-links
    Species: Human
    Verified Customer | Posted 03/24/2017
    After the rabbit anti-DNA polymerase beta antibody from Novus Biologicals NB100-91734, which this lab has been using for DPC assay, being discontinued by Novus biologicals, we have been looking for an available antibody for the application of DPC assay. LN428 human cancer cells were treated by 100 uM of 1,10-Phenanthroline-Copper (II) complex to induce genomic DNA damages (DNA-protein cross-links); a serial of amount of gDNA samples (0, 200, 500, 1000 and 2000ng) were prepared and gDNA samples were blotted onto nitrocellulose membrane and probed for DNA polymerase beta which was trapped on the sites of gDNA damages. The NBP2-38600 antibody was compared with the discontinued DNA Polymerase beta antibody NB100-91734, which we have been using and has been working very well for DPC assay, The result showed that NBP2-38600 worked as good as, or evenbetter than, the discontinued NB100-91734. Slot blot DPC assay, a new and widely-used technique to detect DNA-Protein Cross-links (DPC) - induced by oxidative stresses in vitro (in tubes) or in vivo (in cells).
    DNA Polymerase beta Antibody - BSA Free NBP2-38600

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...