Dysferlin Antibody (3U1P9)

Novus Biologicals | Catalog # NBP3-15781

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3U1P9 expressed in HEK293
View all Dysferlin Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Dysferlin (O75923). FEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

237 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Dysferlin Antibody (3U1P9)

Western Blot: Dysferlin Antibody (3U1P9) [NBP3-15781]

Western Blot: Dysferlin Antibody (3U1P9) [NBP3-15781]

Western Blot: Dysferlin Antibody (3U1P9) [NBP3-15781] - Western blot analysis of extracts of RD cells, using Dysferlin Rabbit mAb (NBP3-15781) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Dysferlin Antibody (3U1P9)

Immunohistochemistry: Dysferlin Antibody (3U1P9) [Dysferlin] -

Immunohistochemistry: Dysferlin Antibody (3U1P9) [Dysferlin] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Dysferlin Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Dysferlin Antibody (3U1P9)

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] -

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Dysferlin Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Dysferlin Antibody (3U1P9)

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] -

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Dysferlin Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Dysferlin Antibody (3U1P9)

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] -

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Dysferlin Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Dysferlin Antibody (3U1P9)

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] -

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Dysferlin Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Dysferlin Antibody (3U1P9)

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] -

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] - Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using Dysferlin Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Dysferlin Antibody (3U1P9)

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] -

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] - Immunohistochemistry analysis of paraffin-embedded Mouse heart tissue using Dysferlin Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Dysferlin Antibody (3U1P9)

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] -

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Dysferlin Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Dysferlin Antibody (3U1P9)

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] -

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] - Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using Dysferlin Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Dysferlin Antibody (3U1P9)

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] -

Immunohistochemistry: Dysferlin Antibody (3U1P9) [NBP3-15781] - Immunohistochemistry analysis of paraffin-embedded Mouse skeletal muscle tissue using Dysferlin Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for Dysferlin Antibody (3U1P9)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunohistochemistry

1:100 - 1:500

Immunohistochemistry-Paraffin

1:100 - 1:500

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Dysferlin

Dysferlin is the protein product of the 2p13 gene that is defective in patients with Limb-Girdle Muscular Dystrophy type 2B (LGMD2B) and Miyoshi Myopathy (MM). Dysferlin is normally localized to the muscle plasma membrane. In patients with LGMD2B and MM, immunoreactivity to dysferlin is severely reduced or lost, depending on the type of mutation. This antibody is used for the characterization of LGMD2B and MM.

Alternate Names

dysferlin, dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive), dystrophy-associated fer-1-like 1, FER1L1Dystrophy-associated fer-1-like protein, Fer-1-like protein 1, FLJ00175, FLJ90168, LGMD2B

Gene Symbol

DYSF

Additional Dysferlin Products

Product Documents for Dysferlin Antibody (3U1P9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Dysferlin Antibody (3U1P9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dysferlin Antibody (3U1P9)

There are currently no reviews for this product. Be the first to review Dysferlin Antibody (3U1P9) and earn rewards!

Have you used Dysferlin Antibody (3U1P9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies