EAAT1/GLAST-1/SLC1A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84940

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: NGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EAAT1/GLAST-1/SLC1A3 Antibody - BSA Free

Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940]

Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940]

Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940] - Analysis in human cerebral cortex and pancreas tissues. Corresponding SLC1A3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940]

Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940]

Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940] - Staining of human cerebral cortex, kidney, skeletal muscle and thyroid gland using Anti-PDIA3 antibody (A) NBP1-84940 shows similar protein distribution across tissues to independent antibody NBP1-84939 (B).
Immunocytochemistry/ Immunofluorescence: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940]

Immunocytochemistry/ Immunofluorescence: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940]

Immunocytochemistry/Immunofluorescence: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940]

Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940]

Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940]

Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940]

Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940] - Staining of human liver shows no positivity in hepatocytes.
Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940]

Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940]

Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940] - Staining of human lymph node shows no positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940]

Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940]

Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Applications for EAAT1/GLAST-1/SLC1A3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EAAT1/GLAST-1

Human excitatory amino acid transporters (EAATs) are members of a family of high affinity sodium-dependent transporter molecules that regulate neurotransmitter concentrations at the excitatory glutamatergic synapses of the mammalian central nervous system. It is believed that these proteins reduce extracellular glutamate concentration, thereby modulating synaptic signaling. In addition, EAATs may also be important for the prevention of glutamate excitotoxicity. EAAT1 is prominently expressed in the frontal cortex, hippocampus and basal ganglia and is also reported to be found in heart, placenta, lung and striated muscle. EAAT1 shares some pharmacological similarities with EAAT3 and both are potent antagonists that appear to specifically block transport mediated by EAAT2. EAAT1 transports L-glutamate and also L- and D-aspartate, acting as a symport by co-transporting sodium. EAAT1 is essential for terminating the postsynaptic action of glutamate, by rapidly removing released glutamate from the synaptic cleft.

Long Name

Excitatory Amino Acid Transporter 1/Sodium-dependent Glu/Asp Transporter 1

Alternate Names

EA6, GLAST-1, GLAST1, SLC1A3

Gene Symbol

SLC1A3

Additional EAAT1/GLAST-1 Products

Product Documents for EAAT1/GLAST-1/SLC1A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EAAT1/GLAST-1/SLC1A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EAAT1/GLAST-1/SLC1A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EAAT1/GLAST-1/SLC1A3 Antibody - BSA Free and earn rewards!

Have you used EAAT1/GLAST-1/SLC1A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies