EB2 Antibody (4D7) - Azide and BSA Free

Novus Biologicals | Catalog # H00010982-M03

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 4D7

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

MAPRE2 (NP_055083, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHD

Specificity

MAPRE2 (4D7)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for EB2 Antibody (4D7) - Azide and BSA Free

Western Blot: EB2 Antibody (4D7) [H00010982-M03]

Western Blot: EB2 Antibody (4D7) [H00010982-M03]

Western Blot: EB2 Antibody (4D7) [H00010982-M03] - Analysis of MAPRE2 expression in K-562 (Cat # L009V1).
Immunocytochemistry/ Immunofluorescence: EB2 Antibody (4D7) [H00010982-M03]

Immunocytochemistry/ Immunofluorescence: EB2 Antibody (4D7) [H00010982-M03]

Immunocytochemistry/Immunofluorescence: EB2 Antibody (4D7) [H00010982-M03] - Analysis of monoclonal antibody to MAPRE2 on HeLa cell. Antibody concentration 35 ug/ml
Immunohistochemistry-Paraffin: EB2 Antibody (4D7) [H00010982-M03]

Immunohistochemistry-Paraffin: EB2 Antibody (4D7) [H00010982-M03]

Immunohistochemistry-Paraffin: EB2 Antibody (4D7) [H00010982-M03] - Analysis of monoclonal antibody to MAPRE2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml
Western Blot: EB2 Antibody (4D7) [H00010982-M03]

Western Blot: EB2 Antibody (4D7) [H00010982-M03]

Western Blot: EB2 Antibody (4D7) [H00010982-M03] - Analysis of MAPRE2 expression in transfected 293T cell line by MAPRE2 monoclonal antibody (M03), clone 4D7. Lane 1: MAPRE2 transfected lysate (Predicted MW: 37 KDa). Lane 2: Non-transfected lysate.

Applications for EB2 Antibody (4D7) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: EB2

The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. The function of this protein is unknown; however, its homology suggests involvement in tumorigenesis of colorectal cancers and proliferative control of normal cells. This gene may belong to the intermediate/early gene family, involved in the signal transduction cascade downstream of the TCR.

Alternate Names

APC-binding protein EB2, EB1, EB2APC-binding protein EB1, End-binding protein 2, microtubule-associated protein, RP/EB family, member 2, RP1microtubule-associated protein RP/EB family member 2, T-cell activation protein, EB1 family

Entrez Gene IDs

10982 (Human)

Gene Symbol

MAPRE2

OMIM

605789 (Human)

Additional EB2 Products

Product Documents for EB2 Antibody (4D7) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EB2 Antibody (4D7) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EB2 Antibody (4D7) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review EB2 Antibody (4D7) - Azide and BSA Free and earn rewards!

Have you used EB2 Antibody (4D7) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...