eEF-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57792

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all eEF-2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit eEF-2 Antibody - BSA Free (NBP2-57792) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for eEF-2 Antibody - BSA Free

Western Blot: eEF-2 Antibody [NBP2-57792]

Western Blot: eEF-2 Antibody [NBP2-57792]

Western Blot: eEF-2 Antibody [NBP2-57792] - Analysis using Anti-EEF2 antibody NBP2-57792 (A) shows similar pattern to independent antibody NBP2-56755 (B).
Immunocytochemistry/ Immunofluorescence: eEF-2 Antibody [NBP2-57792]

Immunocytochemistry/ Immunofluorescence: eEF-2 Antibody [NBP2-57792]

Immunocytochemistry/Immunofluorescence: eEF-2 Antibody [NBP2-57792] - Staining of human cell line HEK 293 shows localization to plasma membrane, cytosol & aggresome.
Immunohistochemistry-Paraffin: eEF-2 Antibody [NBP2-57792]

Immunohistochemistry-Paraffin: eEF-2 Antibody [NBP2-57792]

Immunohistochemistry-Paraffin: eEF-2 Antibody [NBP2-57792] - Immunohistochemical staining of human ovary shows stroma positivity.
Western Blot: eEF-2 Antibody [NBP2-57792]

Western Blot: eEF-2 Antibody [NBP2-57792]

Western Blot: eEF-2 Antibody [NBP2-57792] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Applications for eEF-2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: eEF-2

The eukaryotic translation Elongation Factor 2 (eEF2) is a 95 kDa member of the G-protein superfamily. Following peptide bond formation, eEF2 catalyzes translocation of the deacylated tRNA in the P-site and peptidyl tRNA in the A-site into the E- and P- sites, respectively (1). The activity of eEF2 is regulated by phosphorylation (2). To be active, eEF2 must be dephosphorylated, and phosphorylation at Thr-56 causes inactivation, resulting in the termination of mRNA translation (3). eEF2 is phosphorylated by a specific, calcium and calmodulin (Ca/CaM)-dependent eEF2 kinase (4).

Long Name

Eukaryotic Translation Elongation Factor 2

Alternate Names

eEF2

Gene Symbol

EEF2

Additional eEF-2 Products

Product Documents for eEF-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for eEF-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for eEF-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review eEF-2 Antibody - BSA Free and earn rewards!

Have you used eEF-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

mTOR Signaling Pathway mTOR Signaling Pathway Thumbnail