EEF1B2 Antibody (3A5) - Azide and BSA Free

Novus Biologicals | Catalog # H00001933-M10

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3A5

Format

Azide and BSA Free
View all EEF1B2 Primary Antibodies »

Product Specifications

Immunogen

EEF1B2 (NP_001950.1, 29 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSG

Specificity

EEF1B2 - eukaryotic translation elongation factor 1 beta 2 (3A5)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for EEF1B2 Antibody (3A5) - Azide and BSA Free

Western Blot: EEF1B2 Antibody (3A5) [H00001933-M10]

Western Blot: EEF1B2 Antibody (3A5) [H00001933-M10]

Western Blot: EEF1B2 Antibody (3A5) [H00001933-M10] - Analysis of EEF1B2 expression in HeLa (Cat # L013V1).

Applications for EEF1B2 Antibody (3A5) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: EEF1B2

This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq]

Alternate Names

EEF1B, EEF1B1, EF1B, EF-1-beta, elongation factor 1-beta, eukaryotic translation elongation factor 1 beta 1, eukaryotic translation elongation factor 1 beta 2

Entrez Gene IDs

1933 (Human)

Gene Symbol

EEF1B2

UniProt

NP_001950.1 (Human)

Additional EEF1B2 Products

Product Documents for EEF1B2 Antibody (3A5) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EEF1B2 Antibody (3A5) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for EEF1B2 Antibody (3A5) - Azide and BSA Free

Customer Reviews for EEF1B2 Antibody (3A5) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review EEF1B2 Antibody (3A5) - Azide and BSA Free and earn rewards!

Have you used EEF1B2 Antibody (3A5) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies