EIF4A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85268

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EIF4A3 Antibody - BSA Free

Western Blot: EIF4A3 Antibody [NBP1-85268]

Western Blot: EIF4A3 Antibody [NBP1-85268]

Western Blot: EIF4A3 Antibody [NBP1-85268] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: EIF4A3 Antibody [NBP1-85268]

Immunocytochemistry/ Immunofluorescence: EIF4A3 Antibody [NBP1-85268]

Immunocytochemistry/Immunofluorescence: EIF4A3 Antibody [NBP1-85268] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EIF4A3 Antibody [NBP1-85268]

Immunohistochemistry-Paraffin: EIF4A3 Antibody [NBP1-85268]

Immunohistochemistry-Paraffin: EIF4A3 Antibody [NBP1-85268] - Staining in human testis and pancreas tissues using anti-EIF4A3 antibody. Corresponding EIF4A3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: EIF4A3 Antibody [NBP1-85268]

Immunohistochemistry-Paraffin: EIF4A3 Antibody [NBP1-85268]

Immunohistochemistry-Paraffin: EIF4A3 Antibody [NBP1-85268] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: EIF4A3 Antibody [NBP1-85268]

Immunohistochemistry-Paraffin: EIF4A3 Antibody [NBP1-85268]

Immunohistochemistry-Paraffin: EIF4A3 Antibody [NBP1-85268] - Staining of human testis shows high expression.

Applications for EIF4A3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EIF4A3

EIF4A3 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a nuclear matrix protein. Its amino acid sequence is highly similar to the amino acid sequences of the translation initiation factors eIF4AI and eIF4AII, two other members of the DEAD box protein family.

Alternate Names

ATP-dependent RNA helicase DDX48, ATP-dependent RNA helicase eIF4A-3, DDX48, DEAD (Asp-Glu-Ala-Asp) box polypeptide 48, DEAD box protein 48, DKFZp686O16189, EC 3.6.1, EC 3.6.4.13, EIF4AIII, eIF-4A-III, eIF4A-III, eukaryotic initiation factor 4A-III, Eukaryotic initiation factor 4A-like NUK-34, eukaryotic translation initiation factor 4A, Eukaryotic translation initiation factor 4A isoform 3, eukaryotic translation initiation factor 4A3, hNMP 265, KIAA0111eukaryotic translation initiation factor 4A, isoform 3, MGC10862, NMP 265, NMP265, Nuclear matrix protein 265, NUK34

Gene Symbol

EIF4A3

Additional EIF4A3 Products

Product Documents for EIF4A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EIF4A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EIF4A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EIF4A3 Antibody - BSA Free and earn rewards!

Have you used EIF4A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...