eIF4G1 Antibody (0B8X7)

Name: eIF4G1 Antibody (0B8X7)
Brand: Novus Biologicals
SKU: NBP3-33508
Price: 449 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-33508

Submit a review

Product Documents

100% Guarantee

Product Specifications
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 0B8X7

View all eIF4G1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 551-650 of human eIF4G1 (NP_937884.2).

Sequence:
GSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANKTPLR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

175 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications for eIF4G1 Antibody (0B8X7)

Application

Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: eIF4G1

eIF4G1 (eukaryotic translation Initiation Factor 4 Gamma 1) is a component of the protein complex eIF-4 which is involved in the recognition of the mRNA cap ATP-dependent unwinding of the terminal secondary structure and recruitment of mRNA to the ribosome. eIF4G plays a critical role in protein expression and is at the center of a complex regulatory network. Together with the cap-binding protein eIF4E, it recruits the small ribosomal subunit to the end of mRNA and promotes the assembly of a functional translation initiation complex which scans along the mRNA to the translation start codon. Human eIF4G contains three consecutive HEAT domains, as well as long unstructured regions involved in multiple protein-protein interactions. The interactions of eIF4G1 with other factors are largely unknown.

Long Name

Eukaryotic Translation Initiation Factor 4 gamma 1

Alternate Names

DKFZp686A1451, EIF4F, eIF-4G 1, eIF-4G1, EIF4-gamma, eIF-4-gamma 1, EIF4GI, EIF4Gp220, eucaryotic translation initiation factor 4G, eukaryotic translation initiation factor 4 gamma 1, eukaryotic translation initiation factor 4 gamma, 1, P220

Gene Symbol

EIF4G1

Additional eIF4G1 Products

Product Documents for eIF4G1 Antibody (0B8X7)

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for eIF4G1 Antibody (0B8X7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Translation Regulation

Customer Reviews for eIF4G1 Antibody (0B8X7)

There are currently no reviews for this product. Be the first to review eIF4G1 Antibody (0B8X7) and earn rewards!

Have you used eIF4G1 Antibody (0B8X7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image