ELAVL4 Antibody (6B9) - Azide and BSA Free

Novus Biologicals | Catalog # H00001996-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 6B9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

ELAVL4 (NP_068771, 312 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS

Specificity

ELAVL4 - ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for ELAVL4 Antibody (6B9) - Azide and BSA Free

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01]

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01]

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - Analysis of ELAVL4 expression in transfected 293T cell line by ELAVL4 monoclonal antibody (M01), clone 6B9.Lane 1: ELAVL4 transfected lysate(40.4 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: ELAVL4 Antibody (6B9) [H00001996-M01]

Immunohistochemistry-Paraffin: ELAVL4 Antibody (6B9) [H00001996-M01]

Immunohistochemistry-Paraffin: ELAVL4 Antibody (6B9) [H00001996-M01] - Analysis of monoclonal antibody to ELAVL4 on formalin-fixed paraffin-embedded human cerebral cortex. Antibody concentration 1.2 ug/ml.
Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01]

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01]

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - Analysis of ELAVL4 over-expressed 293 cell line, cotransfected with ELAVL4 Validated Chimera RNAi ( Cat # H00001996-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ELAVL4 monoclonal antibody (M01), clone 6B9 (Cat # H00001996-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01]

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01]

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - ELAVL4 monoclonal antibody (M01), clone 6B9. Analysis of ELAVL4 expression in PC-12.
Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01]

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01]

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - ELAVL4 monoclonal antibody (M01), clone 6B9 Analysis of ELAVL4 expression in IMR-32.
Sandwich ELISA: ELAVL4 Antibody (6B9) [H00001996-M01] - Detection limit for recombinant GST tagged ELAVL4 is approximately 1ng/ml as a capture antibody.

Applications for ELAVL4 Antibody (6B9) - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Sandwich ELISA

1:100-1:2000

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ELAVL4

ELAVL4 may play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3'-UTR. Binds to AU-rich sequences (AREs) of target mRNAs, includingVEGF and FOS mRNA

Alternate Names

abnormal vision, Drosophila, homolog of, like-4, ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D), HuD, Paraneoplastic encephalomyelitis antigen HuD

Entrez Gene IDs

1996 (Human)

Gene Symbol

ELAVL4

OMIM

168360 (Human)

Additional ELAVL4 Products

Product Documents for ELAVL4 Antibody (6B9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ELAVL4 Antibody (6B9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ELAVL4 Antibody (6B9) - Azide and BSA Free

Customer Reviews for ELAVL4 Antibody (6B9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ELAVL4 Antibody (6B9) - Azide and BSA Free and earn rewards!

Have you used ELAVL4 Antibody (6B9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...