ELOVL5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33500

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ELOVL5 Antibody - BSA Free

Western Blot: ELOVL5 Antibody [NBP2-33500]

Western Blot: ELOVL5 Antibody [NBP2-33500]

Western Blot: ELOVL5 Antibody [NBP2-33500] - Analysis in human cell lines U-251MG and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: ELOVL5 Antibody [NBP2-33500]

Immunocytochemistry/ Immunofluorescence: ELOVL5 Antibody [NBP2-33500]

Immunocytochemistry/Immunofluorescence: ELOVL5 Antibody [NBP2-33500] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500]

Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500]

Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500]

Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500]

Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500] - Staining in human breast and pancreas tissues using anti-ELOVL5 antibody. Corresponding ELOVL5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500]

Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500]

Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500] - Analysis in human breast and skeletal muscle tissues. Corresponding ELOVL5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500]

Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500]

Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500]

Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500]

Immunohistochemistry-Paraffin: ELOVL5 Antibody [NBP2-33500] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.

Applications for ELOVL5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 -1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ELOVL5

ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids (Leonard et al., 2000)

Alternate Names

dJ483K16.1, EC 2.3.1.n8, elongation of very long chain fatty acids protein 5, ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, ELOVL2,3-keto acyl-CoA synthase ELOVL5, Fatty acid elongase 1, hELO1, HELO1homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2, homolog of yeast long chain polyunsaturated fatty acid elongatio, SUR4/Elo3-like, yeast)

Gene Symbol

ELOVL5

UniProt

Additional ELOVL5 Products

Product Documents for ELOVL5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ELOVL5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ELOVL5 Antibody - BSA Free

Customer Reviews for ELOVL5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ELOVL5 Antibody - BSA Free and earn rewards!

Have you used ELOVL5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...