ENO3 Antibody (5D1) - Azide and BSA Free

Novus Biologicals | Catalog # H00002027-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Rat, Bovine

Cited:

Bovine

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Dot Blot, Knockdown Validated

Cited:

Western Blot, Cytometric Bead Assay Standard

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 5D1

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG

Reactivity Notes

Bovine reactivity reported in multiple pieces of scientific literature.

Specificity

ENO3 - enolase 3 (beta, muscle)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for ENO3 Antibody (5D1) - Azide and BSA Free

Western Blot: ENO3 Antibody (5D1) [H00002027-M01]

Western Blot: ENO3 Antibody (5D1) [H00002027-M01]

Western Blot: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody (M01), clone 5D1.Lane 1: ENO3 transfected lysate(46.9 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: ENO3 Antibody (5D1) [H00002027-M01]

Immunocytochemistry/ Immunofluorescence: ENO3 Antibody (5D1) [H00002027-M01]

Immunocytochemistry/Immunofluorescence: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of monoclonal antibody to ENO3 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: ENO3 Antibody (5D1) [H00002027-M01]

Immunohistochemistry-Paraffin: ENO3 Antibody (5D1) [H00002027-M01]

Immunohistochemistry-Paraffin: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Western Blot: ENO3 Antibody (5D1) [H00002027-M01]

Western Blot: ENO3 Antibody (5D1) [H00002027-M01]

Western Blot: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of ENO3 over-expressed 293 cell line, cotransfected with ENO3 Validated Chimera RNAi ( Cat # H00002027-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ENO3 monoclonal antibody (M01), clone 5D1 (Cat # H00002027-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: ENO3 Antibody (5D1) [H00002027-M01]

Western Blot: ENO3 Antibody (5D1) [H00002027-M01]

Western Blot: ENO3 Antibody (5D1) [H00002027-M01] - ENO3 monoclonal antibody (M01), clone 5D1 Analysis of ENO3 expression in HeLa.
Immunohistochemistry-Paraffin: ENO3 Antibody (5D1) [H00002027-M01]

Immunohistochemistry-Paraffin: ENO3 Antibody (5D1) [H00002027-M01]

Immunohistochemistry-Paraffin: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1.5 ug/ml.
ELISA: ENO3 Antibody (5D1) [H00002027-M01]

ELISA: ENO3 Antibody (5D1) [H00002027-M01]

ELISA: ENO3 Antibody (5D1) [H00002027-M01] - Detection limit for recombinant GST tagged ENO3 is approximately 0.03ng/ml as a capture antibody.

Applications for ENO3 Antibody (5D1) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. Use in Dot blot reported in scientific literature (PMID:26344128).

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ENO3

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5' UTR.

Alternate Names

2-phospho-D-glycerate hydrolyase, 2-phospho-D-glycerate hydro-lyase, beta-enolase, EC 4.2.1, EC 4.2.1.11, Enolase 3, enolase 3 (beta, muscle), enolase 3, (beta, muscle), GSD13, MSE, Muscle-specific enolase, Skeletal muscle enolase

Entrez Gene IDs

2027 (Human)

Gene Symbol

ENO3

OMIM

131370 (Human)

Additional ENO3 Products

Product Documents for ENO3 Antibody (5D1) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ENO3 Antibody (5D1) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ENO3 Antibody (5D1) - Azide and BSA Free

Customer Reviews for ENO3 Antibody (5D1) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ENO3 Antibody (5D1) - Azide and BSA Free and earn rewards!

Have you used ENO3 Antibody (5D1) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...