EPB41L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-31650

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KKAQEEAPQQPEAAAAVTTPVTPAGHGHPEANSNEKHPSQQDTRPAEQSLDMEEKDYSEADGLSERTTPSKAQKSPQKIAK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EPB41L1 Antibody - BSA Free

Western Blot: EPB41L1 Antibody [NBP2-31650]

Western Blot: EPB41L1 Antibody [NBP2-31650]

Western Blot: EPB41L1 Antibody [NBP2-31650] - Analysis using Anti-EPB41L1 antibody NBP2-31650 (A) shows similar pattern to independent antibody NBP2-31572 (B).
Immunocytochemistry/ Immunofluorescence: EPB41L1 Antibody [NBP2-31650]

Immunocytochemistry/ Immunofluorescence: EPB41L1 Antibody [NBP2-31650]

Immunocytochemistry/Immunofluorescence: EPB41L1 Antibody [NBP2-31650] - Immunofluorescent staining of human cell line A549 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650]

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650]

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650] - Staining of human colon.
Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650]

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650]

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650] - Staining of human cerebral cortex shows strong positivity in neuropil and a subset of glial cells.
Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650]

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650]

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650] - Staining of human adrenal gland, cerebral cortex, colon and kidney using Anti-EPB41L1 antibody NBP2-31650 (A) shows similar protein distribution across tissues to independent antibody NBP2-31572 (B).
Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650]

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650]

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650] - Staining of human kidney.
Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650]

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650]

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650]

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650]

Immunohistochemistry-Paraffin: EPB41L1 Antibody [NBP2-31650] - Staining of human adrenal gland.

Applications for EPB41L1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EPB41L1

Erythrocyte membrane protein band 4.1 (EPB41) is a multifunctional protein that mediates interactions between the erythrocyte cytoskeleton and the overlying plasma membrane. The protein encoded by this gene is a neuronally-enriched protein that is structurally similar to EPB41. The encoded protein binds and stabilizes D2 and D3 dopamine receptors at the neuronal plasma membrane. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them has been determined. [provided by RefSeq]

Alternate Names

band 4.1-like protein 1, DKFZp686H17242, erythrocyte membrane protein band 4.1-like 1, KIAA0338Neuronal protein 4.1,4.1N, MGC11072, neuron-type nonerythroid protein 4.1

Gene Symbol

EPB41L1

UniProt

Additional EPB41L1 Products

Product Documents for EPB41L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EPB41L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EPB41L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EPB41L1 Antibody - BSA Free and earn rewards!

Have you used EPB41L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...