Ephrin-B2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84830

Novus Biologicals
Loading...

Key Product Details

Validated by

Biological Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Mouse, Rat

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ephrin-B2 Antibody - BSA Free

Western Blot: Ephrin-B2 Antibody [NBP1-84830]

Western Blot: Ephrin-B2 Antibody [NBP1-84830]

Ephrin-B2-Antibody-Western-Blot-NBP1-84830-img0009.jpg
Immunocytochemistry/ Immunofluorescence: Ephrin-B2 Antibody [NBP1-84830]

Immunocytochemistry/ Immunofluorescence: Ephrin-B2 Antibody [NBP1-84830]

Immunocytochemistry/Immunofluorescence: Ephrin-B2 Antibody [NBP1-84830] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830]

Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830]

Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human placenta shows moderate membranous positivity in endothelial cells.
Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830]

Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830]

Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human colon shows weak to moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830]

Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830]

Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830]

Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830]

Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human lung shows weak to moderate membranous positivity in pneumocytes.
Ephrin-B2 Antibody

Western Blot: Ephrin-B2 Antibody [NBP1-84830] -

Western Blot: Ephrin-B2 Antibody [NBP1-84830] - Colonic levels of EphB4 & ephrin-B2 mRNA. (A) Representative agarose gels showing mRNA levels of EphB4, ephrin-B2 & GAPDH from the colon of vehicle-treated normal mice (N; n = 7) & of TNBS-treated mice administered with vehicle (CNT; n = 4) or EphB4 20 µg/kg (EphB; n = 5). Histograms represent the quantification of EphB4 (B) & ephrin-B2 (C) mRNA levels normalized to GAPDH amplification products. Transcript X1 (black bars) & transcript X2 (white bars), encoded by ephrin-B2 gene, were detected & represented (C). Data are shown as mean ± SEM. *P < 0.05 vs. N mice, one-way ANOVA followed by Bonferroni’s post-test. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31297055), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Ephrin-B2 Antibody - BSA Free Western Blot: Ephrin-B2 Antibody - BSA Free [NBP1-84830]

Western Blot: Ephrin-B2 Antibody - BSA Free [NBP1-84830]

Analysis in human cell line HEK 293.

Applications for Ephrin-B2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ephrin-B2

Ephrins are naturally divided into two structural groups. All ligands share a conserved extracellular sequence, which most likely corresponds to the receptor-binding domain. This conserved sequence consists of approximately 125 amino acids and includes four invariant cysteines. The B-class ligands are transmembrane proteins, which can be tyrosine phosphorylated upon receptor ligation. Class B ephrins show 33% amino acid sequence identity in their extracellular segments and 44% amino acid sequence identity in their cytoplasmic regions.

Alternate Names

EFNB2, ELF-2, EphrinB2, Htk-L, LERK-5, NLERK-1

Gene Symbol

EFNB2

Additional Ephrin-B2 Products

Product Documents for Ephrin-B2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ephrin-B2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Ephrin-B2 Antibody - BSA Free

Customer Reviews for Ephrin-B2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ephrin-B2 Antibody - BSA Free and earn rewards!

Have you used Ephrin-B2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...