EPRS Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-84929
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELA
Reactivity Notes
Mouse (88%), Rat (89%).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for EPRS Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: EPRS Antibody [NBP1-84929]
Immunocytochemistry/Immunofluorescence: EPRS Antibody [NBP1-84929] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929]
Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929]
Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929] - Staining of human cerebral cortex shows high expression.Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929]
Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929]
Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929] - Staining of human endometrium shows moderate cytoplasmic postivity in glandular cells.Western Blot: EPRS Antibody - BSA Free [NBP1-84929] -
Identification of MA residues critical for interaction with EPRS. (A) Alanine-scanning mutagenesis screen to identify interaction-ablative MA mutants. MA residues were mutated to alanine in groups of three. A total of 43 mutants were generated and tested for EPRS interaction via co-IP. Five mutants with robust MA expression but significantly reduced EPRS interaction are indicated with red boxes. EPRS IP/input ratio (normalized to WT) is labeled below each lane. Mutations of interest were selected based on two criteria: (1) low IP/input ratio; (2) MA-FLAG expression is comparable to WT. (B) Production of progeny virions by MA mutants as measured via luciferase activity in producer cells (top). Gag expression in producer cells and HIV-1 CA in supernatants as assessed by immunoblotting (bottom). The top of the bars represents mean value of 3 trials. (C) Relative infectivity of virion-containing supernatants measured by luciferase activity in target cells. The top of the bars represents mean value of 3 trials. (D) Critical interacting residues (orange) mapped onto a previously reported crystal structure of MA binding to PI(4,5)P2 (PDB: 2H3Z) [52]. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36851687), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: EPRS Antibody - BSA Free [NBP1-84929] -
EPRS protein levels are not altered in cells infected with single-cycle HIV-1. (A) Immunoblot showing level of EPRS in HEK293T cells uninfected or infected with HIV-Luc/VSV-G with M.O.I. of 5. (B) Immunoblot showing level of EPRS in HuT/CCR5 cells uninfected or infected with HIV-Luc/VSV-G with MOI of 0.5 (+) or 2.5 (++). Graph shows level of infectivity as measured by luciferase production. (C) Immunofluorescence imaging of Gag-GFP and EPRS expression in HeLa cells infected with HIV-Luc/VSV-G. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36851687), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for EPRS Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50-1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: EPRS
Alternate Names
bifunctional aminoacyl-tRNA synthetase, Cell proliferation-inducing gene 32 protein, DKFZp313B047, EARS, EC 6.1.1, EC 6.1.1.15, EC 6.1.1.18, GLNS, GLUPRORS, glutamate tRNA ligase, glutaminyl-tRNA synthetase, glutamyl-prolyl-tRNA synthetase, PARSproliferation-inducing gene 32 protein, proliferation-inducing protein 32, proline tRNA ligase, proline-tRNA ligase, prolyl-tRNA synthetase, QARS, QPRS
Gene Symbol
EPRS1
Additional EPRS Products
Product Documents for EPRS Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for EPRS Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for EPRS Antibody - BSA Free
Customer Reviews for EPRS Antibody - BSA Free
There are currently no reviews for this product. Be the first to review EPRS Antibody - BSA Free and earn rewards!
Have you used EPRS Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...