FABP2/I-FABP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87696

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FABP2/I-FABP Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FABP2/I-FABP Antibody - BSA Free

Western Blot: FABP2/I-FABP Antibody [NBP1-87696]

Western Blot: FABP2/I-FABP Antibody [NBP1-87696]

Western Blot: FABP2/I-FABP Antibody [NBP1-87696] - Analysis in control (vector only transfected HEK293T lysate) and FABP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: FABP2/I-FABP Antibody [NBP1-87696]

Immunohistochemistry-Paraffin: FABP2/I-FABP Antibody [NBP1-87696]

Immunohistochemistry-Paraffin: FABP2/I-FABP Antibody [NBP1-87696] - Staining in human small intestine and liver tissues using anti-FABP2 antibody. Corresponding FABP2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: FABP2/I-FABP Antibody [NBP1-87696]

Immunohistochemistry-Paraffin: FABP2/I-FABP Antibody [NBP1-87696]

Immunohistochemistry-Paraffin: FABP2/I-FABP Antibody [NBP1-87696] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FABP2/I-FABP Antibody [NBP1-87696]

Immunohistochemistry-Paraffin: FABP2/I-FABP Antibody [NBP1-87696]

Immunohistochemistry-Paraffin: FABP2/I-FABP Antibody [NBP1-87696] - Staining of human liver shows low expression as expected.

Applications for FABP2/I-FABP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FABP2/I-FABP

The intracellular fatty acid-binding proteins (FABPs) belong to a multigene family with nearly twenty identified members. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Intestinal fatty acid-binding protein 2 gene contains four exons and is an abundant cytosolic protein in small intestine epithelial cells. This gene has a polymorphism at codon 54 that identified an alanine-encoding allele and a threonine-encoding allele. Thr-54 protein is associated with increased fat oxidation and insulin resistance.

Long Name

Fatty Acid-Binding Protein 2/Intestinal FABP

Alternate Names

I-FABP, IFABP, Intestinal FABP

Gene Symbol

FABP2

Additional FABP2/I-FABP Products

Product Documents for FABP2/I-FABP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FABP2/I-FABP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Early Endodermal Lineage Markers
Obesity

Customer Reviews for FABP2/I-FABP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FABP2/I-FABP Antibody - BSA Free and earn rewards!

Have you used FABP2/I-FABP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies