FAM3C Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13996

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FAM3C Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: KTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FAM3C Antibody - BSA Free

Western Blot: FAM3C Antibody [NBP2-13996]

Western Blot: FAM3C Antibody [NBP2-13996]

Western Blot: FAM3C Antibody [NBP2-13996] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: FAM3C Antibody [NBP2-13996]

Immunocytochemistry/ Immunofluorescence: FAM3C Antibody [NBP2-13996]

Immunocytochemistry/Immunofluorescence: FAM3C Antibody [NBP2-13996] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996]

Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996]

Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining of human hippocampus shows strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996]

Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996]

Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996]

Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996]

Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996]

Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996]

Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining in human duodenum and skeletal muscle tissues using anti-FAM3C antibody. Corresponding FAM3C RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996]

Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996]

Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining of human cerebral cortex shows positivity in neurons.
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996]

Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996]

Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining of human placenta shows positivity in trophoblastic cells.

Applications for FAM3C Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000-1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FAM3C

FAM3C is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. Alternate transcriptional splice variants which encode the same protein have been characterized. [provided by RefSeq]

Long Name

Family With Sequence Similarity 3, Member C

Alternate Names

D6WSU176e, ILEI

Gene Symbol

FAM3C

Additional FAM3C Products

Product Documents for FAM3C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FAM3C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Diabetes

Customer Reviews for FAM3C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FAM3C Antibody - BSA Free and earn rewards!

Have you used FAM3C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies