FBXO21 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-36704

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 440-621 of human FBXO21 (NP_055817.1).

Sequence:
PEKVLDILQHIQTLDPGQHGAVGYLVQHTLEHIERKKEEVGVEVKLRSDEKHRDVCYSIGLIMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHSLPHGHHQPFYNVLVEDGSCRYAAQENLEYNVEPQEISHPDVGRYFSEFTGTHYIPNAELEIRYPEDLEFVYETVQNIYSAKKENIDE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for FBXO21 Antibody - BSA Free

FBXO21 Antibody

Western Blot: FBXO21 Antibody [NBP3-36704] -

Western Blot: FBXO21 Antibody [NBP3-36704] - Western blot analysis of various lysates using FBXO21 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
FBXO21 Antibody

Immunohistochemistry: FBXO21 Antibody [NBP3-36704] -

Immunohistochemistry: FBXO21 Antibody [NBP3-36704] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using FBXO21 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
FBXO21 Antibody

Immunohistochemistry: FBXO21 Antibody [NBP3-36704] -

Immunohistochemistry: FBXO21 Antibody [NBP3-36704] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using FBXO21 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
FBXO21 Antibody

Immunohistochemistry: FBXO21 Antibody [NBP3-36704] -

Immunohistochemistry: FBXO21 Antibody [NBP3-36704] - Immunohistochemistry analysis of paraffin-embedded Rat lung using FBXO21 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
FBXO21 Antibody

Immunocytochemistry/ Immunofluorescence: FBXO21 Antibody [NBP3-36704] -

Immunocytochemistry/ Immunofluorescence: FBXO21 Antibody [NBP3-36704] - Immunofluorescence analysis of L929 cells using FBXO21 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for FBXO21 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: FBXO21

Alternate Names

DKFZp434G058, F-box only protein 21, F-box protein 21, FBX21FLJ90233, KIAA0875MGC26682

Gene Symbol

FBXO21

Additional FBXO21 Products

Product Documents for FBXO21 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FBXO21 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FBXO21 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FBXO21 Antibody - BSA Free and earn rewards!

Have you used FBXO21 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...