Ferritin Light Chain Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34072

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTD

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ferritin Light Chain Antibody - BSA Free

Western Blot: Ferritin Light Chain Antibody [NBP2-34072]

Western Blot: Ferritin Light Chain Antibody [NBP2-34072]

Western Blot: Ferritin Light Chain Antibody [NBP2-34072] - Analysis in human lung tissue.
Immunocytochemistry/ Immunofluorescence: Ferritin Light Chain Antibody [NBP2-34072]

Immunocytochemistry/ Immunofluorescence: Ferritin Light Chain Antibody [NBP2-34072]

Immunocytochemistry/Immunofluorescence: Ferritin Light Chain Antibody [NBP2-34072] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.
Ferritin Light Chain Antibody - BSA Free Immunohistochemistry-Paraffin: Ferritin Light Chain Antibody [NBP2-34072]

Immunohistochemistry-Paraffin: Ferritin Light Chain Antibody [NBP2-34072]

Analysis in human lung and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues.
Ferritin Light Chain Antibody - BSA Free Immunohistochemistry-Paraffin: Ferritin Light Chain Antibody [NBP2-34072]

Immunohistochemistry-Paraffin: Ferritin Light Chain Antibody [NBP2-34072]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
Ferritin Light Chain Antibody - BSA Free Immunohistochemistry-Paraffin: Ferritin Light Chain Antibody [NBP2-34072]

Immunohistochemistry-Paraffin: Ferritin Light Chain Antibody [NBP2-34072]

Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.
Ferritin Light Chain Antibody - BSA Free Immunohistochemistry-Paraffin: Ferritin Light Chain Antibody [NBP2-34072]

Immunohistochemistry-Paraffin: Ferritin Light Chain Antibody [NBP2-34072]

Staining of human lung shows strong cytoplasmic positivity in macrophages.
Ferritin Light Chain Antibody - BSA Free Immunohistochemistry-Paraffin: Ferritin Light Chain Antibody [NBP2-34072]

Immunohistochemistry-Paraffin: Ferritin Light Chain Antibody [NBP2-34072]

Staining of human duodenum shows strong cytoplasmic positivity in lymphoid cells.

Applications for Ferritin Light Chain Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ferritin Light Chain

This gene encodes the light subunit of the ferritin protein. Ferritin is the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in this light chain ferritin gene are associated with several neurodegenerative diseases and hyperferritinemia-cataract syndrome. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008]

Alternate Names

Ferritin L subunit, ferritin L-chain, ferritin light chain, ferritin light polypeptide-like 3, ferritin, light polypeptide, MGC71996, NBIA3

Gene Symbol

FTL

UniProt

Additional Ferritin Light Chain Products

Product Documents for Ferritin Light Chain Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ferritin Light Chain Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ferritin Light Chain Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ferritin Light Chain Antibody - BSA Free and earn rewards!

Have you used Ferritin Light Chain Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...