FGL2/Fibroleukin Antibody (6D9) - Azide and BSA Free

Novus Biologicals | Catalog # H00010875-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Flow Cytometry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Functional

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 6D9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

FGL2 (NP_006673, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG

Specificity

FGL2 (6D9)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for FGL2/Fibroleukin Antibody (6D9) - Azide and BSA Free

Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01]

Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01]

Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01] - FGL2 monoclonal antibody (M01), clone 6D9. Analysis of FGL2 expression in Raw 264.7.
Immunohistochemistry-Paraffin: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01]

Immunohistochemistry-Paraffin: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01]

Immunohistochemistry-Paraffin: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01] - Analysis of monoclonal antibody to FGL2 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 0.5 ug/ml.
Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01]

Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01]

Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01] - FGL2 monoclonal antibody (M01), clone 6D9 Analysis of FGL2 expression in HeLa.
Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01]

Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01]

Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01] - FGL2 monoclonal antibody (M01), clone 6D9. Analysis of FGL2 expression in PC-12.
Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01]

Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01]

Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01] - Analysis of FGL2 expression in transfected 293T cell line by FGL2 monoclonal antibody (M01), clone 6D9.Lane 1: FGL2 transfected lysate(50 KDa).Lane 2: Non-transfected lysate.
Immunoprecipitation: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01]

Immunoprecipitation: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01]

Immunoprecipitation: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01] - Analysis of FGL2 transfected lysate using anti-FGL2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FGL2 MaxPab rabbit polyclonal antibody.
ELISA: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01]

ELISA: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01]

ELISA: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01] - Detection limit for recombinant GST tagged FGL2 is approximately 0.1ng/ml as a capture antibody.
FGL2/Fibroleukin Antibody (6D9) - Azide and BSA Free

Flow Cytometry: FGL2/Fibroleukin Antibody (6D9) - Azide and BSA Free [H00010875-M01] -

Inhibition of Fgl2 signaling improves the antitumor effect of immune checkpoint inhibitors. (A–H) MC38 tumor cells were injected subcutaneously into C57BL/6 mice, the mice were administered 100 ug anti-FGL2 ( alpha FGL2) or IgG every 3 days after the tumor size reached 100 mm3. Tumor growth (A), survival of MC38 tumor-bearing mice (B, n=9–10), percentage of CD4+ and CD8+ T cells (C), MDSCs (D), absolute number of G-MDSC and M-MDSC cells (E), macrophages (F) and DCs (G) in tumors, Filipin III staining of MDSCs (H), n=5. (I–M) WT mice were subcutaneously injected with MC38 tumor cells. Tumor-bearing mice were injected with IgG, anti-Fgl2 ( alpha Fgl2), anti-PD-L1 ( alpha PD-L1), or a combination of ɑFGL2 and anti-PD-L1 ( alpha F+P). Tumor growth was monitored (I), and the percentages of CD8+ T cells (J), MDSCs (K), CD8+ T cells producing IFN-gamma (L) and GzmB (M) in the tumor tissues were analyzed by FCM (n=5). (N) Fgl2 promotes the generation and immune suppressive effects of MDSCs via cholesterol metabolism and XBP1 signaling. Data are expressed as mean+/-SD. *p<0.05; **p<0.01; ***p<0.001; ns, no significant difference, by two-tailed unpaired Student’s t-test (A, C–H), log-rank (Mantel-Cox) test (B), one-way or two-way analysis of variance with Sidak multiple comparisons test was used to evaluate statistical significance (I–M). FCM, flow cytometry; Fgl2, fibrinogen-like protein 2; G-MDSCs, granulocytic myeloid-derived suppressor cell; KO, knockout; MDSCs, myeloid-derived suppressor cells; M-MDSC, monocytic myeloid-derived suppressor cell; WT, wild-type. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38056898), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
FGL2/Fibroleukin Antibody (6D9) - Azide and BSA Free

Flow Cytometry: FGL2/Fibroleukin Antibody (6D9) - Azide and BSA Free [H00010875-M01] -

Inhibition of Fgl2 signaling improves the antitumor effect of immune checkpoint inhibitors. (A–H) MC38 tumor cells were injected subcutaneously into C57BL/6 mice, the mice were administered 100 ug anti-FGL2 ( alpha FGL2) or IgG every 3 days after the tumor size reached 100 mm3. Tumor growth (A), survival of MC38 tumor-bearing mice (B, n=9–10), percentage of CD4+ and CD8+ T cells (C), MDSCs (D), absolute number of G-MDSC and M-MDSC cells (E), macrophages (F) and DCs (G) in tumors, Filipin III staining of MDSCs (H), n=5. (I–M) WT mice were subcutaneously injected with MC38 tumor cells. Tumor-bearing mice were injected with IgG, anti-Fgl2 ( alpha Fgl2), anti-PD-L1 ( alpha PD-L1), or a combination of ɑFGL2 and anti-PD-L1 ( alpha F+P). Tumor growth was monitored (I), and the percentages of CD8+ T cells (J), MDSCs (K), CD8+ T cells producing IFN-gamma (L) and GzmB (M) in the tumor tissues were analyzed by FCM (n=5). (N) Fgl2 promotes the generation and immune suppressive effects of MDSCs via cholesterol metabolism and XBP1 signaling. Data are expressed as mean+/-SD. *p<0.05; **p<0.01; ***p<0.001; ns, no significant difference, by two-tailed unpaired Student’s t-test (A, C–H), log-rank (Mantel-Cox) test (B), one-way or two-way analysis of variance with Sidak multiple comparisons test was used to evaluate statistical significance (I–M). FCM, flow cytometry; Fgl2, fibrinogen-like protein 2; G-MDSCs, granulocytic myeloid-derived suppressor cell; KO, knockout; MDSCs, myeloid-derived suppressor cells; M-MDSC, monocytic myeloid-derived suppressor cell; WT, wild-type. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38056898), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for FGL2/Fibroleukin Antibody (6D9) - Azide and BSA Free

Application
Recommended Usage

ELISA

1:100-1:2000

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

0.5ug/mL

Immunoprecipitation

1:10-1:500

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot.

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

  • Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
  • Spillover Popups - Visualize the spectra of individual fluorochromes
  • Antigen Density Selector - Match fluorochrome brightness with antigen density
Build Your Panel Now

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: FGL2

The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites.

Long Name

Fibrinogen-like 2

Alternate Names

Fibroleukin, T49

Entrez Gene IDs

10875 (Human); 14190 (Mouse); 84586 (Rat)

Gene Symbol

FGL2

OMIM

605351 (Human)

UniProt

Additional FGL2 Products

Product Documents for FGL2/Fibroleukin Antibody (6D9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FGL2/Fibroleukin Antibody (6D9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for FGL2/Fibroleukin Antibody (6D9) - Azide and BSA Free

Customer Reviews for FGL2/Fibroleukin Antibody (6D9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review FGL2/Fibroleukin Antibody (6D9) - Azide and BSA Free and earn rewards!

Have you used FGL2/Fibroleukin Antibody (6D9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...