FKBP51/FKBP5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84676

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FKBP51/FKBP5 Antibody - BSA Free

Western Blot: FKBP51/FKBP5 Antibody [NBP1-84676]

Western Blot: FKBP51/FKBP5 Antibody [NBP1-84676]

Western Blot: FKBP51/FKBP5 Antibody [NBP1-84676] - Analysis using Anti-FKBP5 antibody NBP1-84676 (A) shows similar pattern to independent antibody NBP1-84677 (B).
Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676]

Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676]

Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676]

Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676]

Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676] - Staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676]

Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676]

Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676]

Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676]

Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676] - Staining of human kidney shows moderate to strong nuclear positivity in cells in tubules.
FKBP51/FKBP5 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: FKBP51/FKBP5 Antibody - BSA Free [NBP1-84676]

Immunocytochemistry/ Immunofluorescence: FKBP51/FKBP5 Antibody - BSA Free [NBP1-84676]

Staining of human cell line HEK 293 shows localization to nucleoplasm.
FKBP51/FKBP5 Antibody - BSA Free Western Blot: FKBP51/FKBP5 Antibody - BSA Free [NBP1-84676]

Western Blot: FKBP51/FKBP5 Antibody - BSA Free [NBP1-84676]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for FKBP51/FKBP5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FKBP51

FK506 binding proteins (FKBPs) are intracellular receptors for the immunosuppressive drug FK506. The FKBP/FK506 complex inhibits calcineurin, a calcium/calmodulin dependent Ser/Thr phosphatase that functions as a critical signaling molecule during T cell activation. FKBP38 functions as an anti-apoptotic molecule by modulating the intracellular distribution of Bcl-2 and Bcl-xL.

FK506 binding protein, 51 kDa molecular weight (FKBP51) is a peptidyl-prolyl isomerase that catalyzes the transition between cis- and trans- proline residues critical for proper folding of proteins. The macrolide immunosuppressants FK506 and Rapamycin are FKBP51 inhibitors. FKBP51 levels are induced by glucocorticoids. It associates with HSP90 complexes that are critical for the proper folding of steroid receptors. Single nucleotide polymorphisms in FKBP51 have been associated with major depression and hyper-responsiveness to antidepressants.

Long Name

51 kDa FK506 Binding Protein

Alternate Names

Dit1, FKBP5, FKBP54, Ptg-10

Gene Symbol

FKBP5

Additional FKBP51 Products

Product Documents for FKBP51/FKBP5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FKBP51/FKBP5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for FKBP51/FKBP5 Antibody - BSA Free

Customer Reviews for FKBP51/FKBP5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FKBP51/FKBP5 Antibody - BSA Free and earn rewards!

Have you used FKBP51/FKBP5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...