Frequenin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89820

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Frequenin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Frequenin Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Frequenin Antibody [NBP1-89820]

Immunocytochemistry/ Immunofluorescence: Frequenin Antibody [NBP1-89820]

Immunocytochemistry/Immunofluorescence: Frequenin Antibody [NBP1-89820] - Staining of human cell line U-2 OS shows localization to plasma membrane and vesicles.
Frequenin Antibody - BSA Free Immunohistochemistry-Paraffin: Frequenin Antibody - BSA Free [NBP1-89820]

Immunohistochemistry-Paraffin: Frequenin Antibody - BSA Free [NBP1-89820]

Analysis in human cerebral cortex and liver tissues using Anti-NCS1 antibody. Corresponding NCS1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Frequenin Antibody [NBP1-89820]

Immunohistochemistry-Paraffin: Frequenin Antibody [NBP1-89820]

Immunohistochemistry-Paraffin: Frequenin Antibody [NBP1-89820] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Frequenin Antibody [NBP1-89820]

Immunohistochemistry-Paraffin: Frequenin Antibody [NBP1-89820]

Immunohistochemistry-Paraffin: Frequenin Antibody [NBP1-89820] - Staining of human liver shows low expression as expected.
Western Blot: Frequenin Antibody [NBP1-89820]

Western Blot: Frequenin Antibody [NBP1-89820]

Western Blot: Frequenin Antibody [NBP1-89820] - Analysis in control (vector only transfected HEK293T lysate) and NCS1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Frequenin Antibody - BSA Free Western Blot: Frequenin Antibody - BSA Free [NBP1-89820]

Western Blot: Frequenin Antibody - BSA Free [NBP1-89820]

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Mouse Cerebral Cortex tissue
Frequenin Antibody - BSA Free Western Blot: Frequenin Antibody - BSA Free [NBP1-89820]

Western Blot: Frequenin Antibody - BSA Free [NBP1-89820]

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Cerebral Cortex tissue

Applications for Frequenin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Frequenin

Frequenin is a Ca2+ binding protein implicated in the regulation of neurotransmitter release at the neuromuscular junction. Frequenin amino acid sequences from different species appear closely related. In mouse a single 4.2 kbp mRNA is produced yielding a protein of 22 kDa when assayed by SDS-PAGE under reducing conditions. Frequenin may colocalize with the dendritic marker MAP-2 and is widely distributed in the brain, spinal cord and dorsal root ganglia. In Drosophila frequenin is related to recoverin and visinin and functions like Ca2+-sensitive guanylyl cyclase activator.

Alternate Names

DKFZp761L1223, FREQFLUP, frequenin (Drosophila) homolog, Frequenin homolog, frequenin homolog (Drosophila), Frequenin-like protein, Frequenin-like ubiquitous protein, NCS-1, neuronal calcium sensor 1

Gene Symbol

NCS1

Additional Frequenin Products

Product Documents for Frequenin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Frequenin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Frequenin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Frequenin Antibody - BSA Free and earn rewards!

Have you used Frequenin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies