FUBP1 Antibody (1G6X5)

Novus Biologicals | Catalog # NBP3-33539

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1G6X5
View all FUBP1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 545-644 of human FUBP1 (Q96AE4).

Sequence:
YQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQGQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for FUBP1 Antibody (1G6X5)

FUBP1 Antibody (1G6X5)

Western Blot: FUBP1 Antibody (1G6X5) [NBP3-33539] -

Western Blot: FUBP1 Antibody (1G6X5) [NBP3-33539] - Western blot analysis of various lysates using FUBP1 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
FUBP1 Antibody (1G6X5)

Immunocytochemistry/ Immunofluorescence: FUBP1 Antibody (1G6X5) [NBP3-33539] -

Immunocytochemistry/ Immunofluorescence: FUBP1 Antibody (1G6X5) [NBP3-33539] - Confocal imaging of HeLa cells using FUBP1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
FUBP1 Antibody (1G6X5)

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] -

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded rat lung tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
FUBP1 Antibody (1G6X5)

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] -

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded human thyroid tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
FUBP1 Antibody (1G6X5)

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] -

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded rat liver tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
FUBP1 Antibody (1G6X5)

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] -

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded human esophagus tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
FUBP1 Antibody (1G6X5)

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] -

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded human breast cancer tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
FUBP1 Antibody (1G6X5)

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] -

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded mouse intestin tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
FUBP1 Antibody (1G6X5)

Immunocytochemistry/ Immunofluorescence: FUBP1 Antibody (1G6X5) [NBP3-33539] -

Immunocytochemistry/ Immunofluorescence: FUBP1 Antibody (1G6X5) [NBP3-33539] - Confocal imaging of U-2 OS cells using FUBP1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
FUBP1 Antibody (1G6X5)

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] -

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded rat intestine tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
FUBP1 Antibody (1G6X5)

Immunocytochemistry/ Immunofluorescence: FUBP1 Antibody (1G6X5) [NBP3-33539] -

Immunocytochemistry/ Immunofluorescence: FUBP1 Antibody (1G6X5) [NBP3-33539] - Confocal imaging of paraffin-embedded Human breast cancer tissue using FUBP1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
FUBP1 Antibody (1G6X5)

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] -

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded mouse lung tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
FUBP1 Antibody (1G6X5)

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] -

Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded mouse spleen tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for FUBP1 Antibody (1G6X5)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:100 - 1:500

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: FUBP1

FUBP1 encodes a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. This protein has been shown to function as an ATP-dependent DNA helicase.

Alternate Names

far upstream element (FUSE) binding protein 1, far upstream element binding protein, far upstream element-binding protein 1, FBPDNA helicase V, FUBP, FUSE-binding protein 1, hDH V

Gene Symbol

FUBP1

Additional FUBP1 Products

Product Documents for FUBP1 Antibody (1G6X5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FUBP1 Antibody (1G6X5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FUBP1 Antibody (1G6X5)

There are currently no reviews for this product. Be the first to review FUBP1 Antibody (1G6X5) and earn rewards!

Have you used FUBP1 Antibody (1G6X5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies