G protein alpha-13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37921

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human G protein alpha-13 (NP_006563.2).

Sequence:
MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for G protein alpha-13 Antibody - BSA Free

G protein alpha-13 Antibody

Immunohistochemistry: G protein alpha-13 Antibody [NBP3-37921] -

Immunohistochemistry: G protein alpha-13 Antibody [NBP3-37921] - Immunohistochemistry analysis of paraffin-embedded Human stomach using G protein alpha-13 Rabbit pAb (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
G protein alpha-13 Antibody

Immunocytochemistry/ Immunofluorescence: G protein alpha-13 Antibody [NBP3-37921] -

Immunocytochemistry/ Immunofluorescence: G protein alpha-13 Antibody [NBP3-37921] - Immunofluorescence analysis of NIH-3T3 cells using G protein alpha-13 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
G protein alpha-13 Antibody

Immunocytochemistry/ Immunofluorescence: G protein alpha-13 Antibody [NBP3-37921] -

Immunocytochemistry/ Immunofluorescence: G protein alpha-13 Antibody [NBP3-37921] - Immunofluorescence analysis of C6 cells using G protein alpha-13 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
G protein alpha-13 Antibody

Immunohistochemistry: G protein alpha-13 Antibody [NBP3-37921] -

Immunohistochemistry: G protein alpha-13 Antibody [NBP3-37921] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using G protein alpha-13 Rabbit pAb (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
G protein alpha-13 Antibody

Western Blot: G protein alpha-13 Antibody [NBP3-37921] -

Western Blot: G protein alpha-13 Antibody [NBP3-37921] - Western blot analysis of various lysates using G protein alpha-13 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for G protein alpha-13 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: G protein alpha-13

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems

Alternate Names

G alpha-13, G13, G-protein subunit alpha-13, guanine nucleotide binding protein (G protein), alpha 13, guanine nucleotide-binding protein subunit alpha-13, MGC46138

Gene Symbol

GNA13

Additional G protein alpha-13 Products

Product Documents for G protein alpha-13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for G protein alpha-13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for G protein alpha-13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review G protein alpha-13 Antibody - BSA Free and earn rewards!

Have you used G protein alpha-13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...