Gankyrin Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82443
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Cited:
IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPL
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Gankyrin Antibody - BSA Free
Western Blot: Gankyrin Antibody [NBP1-82443]
Western Blot: Gankyrin Antibody [NBP1-82443] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443]
Gankyrin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82443-img0012.jpgImmunohistochemistry-Paraffin: Gankyrin Antibody [NBP1-82443]
Immunohistochemistry-Paraffin: Gankyrin Antibody [NBP1-82443] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells of seminiferous ducts.Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443]
Immunocytochemistry/Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Staining of human cell line A-431 shows positivity in cytoplasm.Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] -
Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] -
Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Gankyrin expression pre-invasive germ cells. a) 1 year old - maturation delay; b) 2 year old – maturation delay; c) 7 year old pre-invasive TGCC; d)17 year old pre-invasive TGCC; & e) 23 year old pre-invasive TGCC. Yellow arrows – GCNIS cells, orange arrows – Sertoli cells. This experiment was performed along with human fetal testis samples, no primary antibody control is the same as on Fig. 1, Scalebars - 50 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] -
Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] -
Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Gankyrin Antibody [NBP1-82443] -
Western Blot: Gankyrin Antibody [NBP1-82443] - Effects of Gankyrin knock-down on Gankyrin & POU5F1 expression. Relative Gankyrin mRNA(a) & protein (b) expression in NTera2 cells after Gankyrin knock-down. Relative POU5F1 mRNA (c) & protein (d) expression in NTera2 cells after Gankyrin knock-down. e Representative Western blot for Gankyrin & POU5F1 expression in (V) vehicle & Gankyrin siRNA (T) transfected NTera2 cells. Tubulin was used as a loading control. Data analysed by paired t-test ± SEM, ***p < 0.001, **p < 0.01. Each data point represents the mean of an individualexperiment, each with 3 replicates. Paired samples from an individual experiment are represented by the same colour. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] -
Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Gankyrin Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500-1:1000
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Gankyrin
Alternate Names
26S proteasome non-ATPase regulatory subunit 10, 26S proteasome regulatory subunit p28, ankyrin repeat protein, dJ889N15.2, Gankyrin, hepatocellular carcinoma-associated protein p28-II, p28, p28(GANK), proteasome (prosome, macropain) 26S subunit, non-ATPase, 10
Gene Symbol
PSMD10
Additional Gankyrin Products
Product Documents for Gankyrin Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Gankyrin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Gankyrin Antibody - BSA Free
Customer Reviews for Gankyrin Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Gankyrin Antibody - BSA Free and earn rewards!
Have you used Gankyrin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...