Gankyrin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82443

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Gankyrin Antibody - BSA Free

Western Blot: Gankyrin Antibody [NBP1-82443]

Western Blot: Gankyrin Antibody [NBP1-82443]

Western Blot: Gankyrin Antibody [NBP1-82443] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443]

Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443]

Gankyrin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82443-img0012.jpg
Immunohistochemistry-Paraffin: Gankyrin Antibody [NBP1-82443]

Immunohistochemistry-Paraffin: Gankyrin Antibody [NBP1-82443]

Immunohistochemistry-Paraffin: Gankyrin Antibody [NBP1-82443] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells of seminiferous ducts.
Western Blot: Gankyrin Antibody [NBP1-82443]

Western Blot: Gankyrin Antibody [NBP1-82443]

Western Blot: Gankyrin Antibody [NBP1-82443] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-PSMD10 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443]

Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443]

Immunocytochemistry/Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Staining of human cell line A-431 shows positivity in cytoplasm.
Knockdown Validated: Gankyrin Antibody [NBP1-82443]

Western Blot: Gankyrin Antibody [NBP1-82443]

Gankyrin-Antibody-Knockdown-Validated-NBP1-82443-img0013.jpg
Gankyrin Antibody

Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] -

Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Gankyrin Antibody

Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] -

Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Gankyrin expression pre-invasive germ cells. a) 1 year old - maturation delay; b) 2 year old – maturation delay; c) 7 year old pre-invasive TGCC; d)17 year old pre-invasive TGCC; & e) 23 year old pre-invasive TGCC. Yellow arrows – GCNIS cells, orange arrows – Sertoli cells. This experiment was performed along with human fetal testis samples, no primary antibody control is the same as on Fig. 1, Scalebars - 50 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Gankyrin Antibody

Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] -

Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Gankyrin Antibody

Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] -

Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Gankyrin Antibody

Western Blot: Gankyrin Antibody [NBP1-82443] -

Western Blot: Gankyrin Antibody [NBP1-82443] - Effects of Gankyrin knock-down on Gankyrin & POU5F1 expression. Relative Gankyrin mRNA(a) & protein (b) expression in NTera2 cells after Gankyrin knock-down. Relative POU5F1 mRNA (c) & protein (d) expression in NTera2 cells after Gankyrin knock-down. e Representative Western blot for Gankyrin & POU5F1 expression in (V) vehicle & Gankyrin siRNA (T) transfected NTera2 cells. Tubulin was used as a loading control. Data analysed by paired t-test ± SEM, ***p < 0.001, **p < 0.01. Each data point represents the mean of an individualexperiment, each with 3 replicates. Paired samples from an individual experiment are represented by the same colour. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Gankyrin Antibody

Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] -

Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Gankyrin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500-1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Gankyrin

Gankyrin is an ankyrin-repeat liver oncoprotein, that plays an important role in controlling the functions of the tumour suppressors RB and p53.

Alternate Names

26S proteasome non-ATPase regulatory subunit 10, 26S proteasome regulatory subunit p28, ankyrin repeat protein, dJ889N15.2, Gankyrin, hepatocellular carcinoma-associated protein p28-II, p28, p28(GANK), proteasome (prosome, macropain) 26S subunit, non-ATPase, 10

Gene Symbol

PSMD10

Additional Gankyrin Products

Product Documents for Gankyrin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Gankyrin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Gankyrin Antibody - BSA Free

Customer Reviews for Gankyrin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Gankyrin Antibody - BSA Free and earn rewards!

Have you used Gankyrin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...