GATA-6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10916

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GATA-6 (NP_005248). Peptide sequence SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GATA-6 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: GATA-6 Antibody [NBP3-10916]

Immunocytochemistry/ Immunofluorescence: GATA-6 Antibody [NBP3-10916]

Immunocytochemistry/Immunofluorescence: GATA-6 Antibody [NBP3-10916] - Immunofluorescence of human embryonic stem cell line H1 differentiated to HNF4 positive hepatic progenitor cells. The antibodies were used at a 1:250 dilution.

Applications for GATA-6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GATA-6

The Gata6 gene is a transcriptional activator that is crucial to modulating terminal differentiation and/or proliferation by regulating SEMA3C and PLXNA2. The Gata6 gene is most prominent during vertebrate development in early and later embryogenesis. Two isoforms exist: isoform 1 is 595 amino acids long at 60 kDa and isoform 2 exists at 449 amino acids in length and 45 kDA. The Gata6 gene focuses on endo- and mesodermally derived cells, thus participating significantly in gut, lung, and heart development and mutations of the Gata6 gene are linked to multiple congenital defects. The Gata6 gene has also been associated with polycystic ovary syndrome, hernias, teratoma, pulmonary fibrosis, germ cell tumor, gastric cancer, Crohn's disease, colorectal cancer, colon cancer, and carcinoma. It is known to interact with KLF13, MED1, HHEX, KLF2, and SP1 as it functions in pathways such as lymphocyte signaling, heart development, hemostasis, and thrombin signaling.

Alternate Names

GATA6

Gene Symbol

GATA6

Additional GATA-6 Products

Product Documents for GATA-6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GATA-6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GATA-6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GATA-6 Antibody - BSA Free and earn rewards!

Have you used GATA-6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...